Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1WVC6

Protein Details
Accession K1WVC6    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-30RLYQKGRILGHKRGKRNSRPNQSLVQHydrophilic
NLS Segment(s)
PositionSequence
15-20HKRGKR
Subcellular Location(s) nucl 10mito 10mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR038661  L35A_sf  
IPR001780  Ribosomal_L35A  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01247  Ribosomal_L35Ae  
Amino Acid Sequences MGATRLYQKGRILGHKRGKRNSRPNQSLVQIDGVDSKEAARSYLGKRIAYVYKAKREINGSRVRVIWGRVTRPHGNSGVVKSKFTSNLPAHIFGASCRVMLYPSTI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.65
3 0.71
4 0.75
5 0.8
6 0.81
7 0.85
8 0.86
9 0.86
10 0.85
11 0.81
12 0.76
13 0.7
14 0.61
15 0.51
16 0.43
17 0.32
18 0.25
19 0.23
20 0.18
21 0.14
22 0.12
23 0.1
24 0.1
25 0.1
26 0.1
27 0.09
28 0.12
29 0.13
30 0.2
31 0.23
32 0.2
33 0.21
34 0.24
35 0.25
36 0.24
37 0.3
38 0.28
39 0.32
40 0.36
41 0.36
42 0.35
43 0.38
44 0.39
45 0.39
46 0.43
47 0.38
48 0.36
49 0.36
50 0.35
51 0.32
52 0.3
53 0.29
54 0.24
55 0.26
56 0.29
57 0.35
58 0.38
59 0.39
60 0.41
61 0.36
62 0.36
63 0.34
64 0.36
65 0.38
66 0.34
67 0.33
68 0.3
69 0.32
70 0.32
71 0.3
72 0.34
73 0.27
74 0.33
75 0.36
76 0.37
77 0.34
78 0.32
79 0.31
80 0.22
81 0.25
82 0.18
83 0.15
84 0.13
85 0.12
86 0.13