Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WPL5

Protein Details
Accession K1WPL5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
128-155FPNAATEKRPWWKRKKAKGLRGRGQMNAHydrophilic
NLS Segment(s)
PositionSequence
135-150KRPWWKRKKAKGLRGR
Subcellular Location(s) mito 10.5, cyto_mito 8.833, cyto 6, cyto_nucl 4.333, plas 4, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSTLVASTVMSQVTDAAATPTQEPSKTTVHDKGYQTENGKKTATTTIPATKETITSTEGFGYKYNSGLIVRVAIAAGIIVMAVLVIILFLKRLRRETILSAQLEEEEKKRGFESAAWSDTPGQAPVFPNAATEKRPWWKRKKAKGLRGRGQMNAYAVYEWEGVPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.07
4 0.08
5 0.09
6 0.1
7 0.11
8 0.15
9 0.17
10 0.18
11 0.19
12 0.2
13 0.23
14 0.25
15 0.3
16 0.33
17 0.36
18 0.43
19 0.44
20 0.45
21 0.45
22 0.47
23 0.46
24 0.47
25 0.44
26 0.4
27 0.39
28 0.34
29 0.32
30 0.32
31 0.29
32 0.23
33 0.25
34 0.28
35 0.29
36 0.3
37 0.29
38 0.24
39 0.23
40 0.22
41 0.19
42 0.15
43 0.14
44 0.14
45 0.14
46 0.14
47 0.14
48 0.14
49 0.15
50 0.13
51 0.13
52 0.12
53 0.11
54 0.1
55 0.1
56 0.1
57 0.07
58 0.07
59 0.06
60 0.06
61 0.05
62 0.04
63 0.03
64 0.03
65 0.02
66 0.02
67 0.01
68 0.01
69 0.01
70 0.01
71 0.01
72 0.01
73 0.01
74 0.01
75 0.01
76 0.02
77 0.03
78 0.07
79 0.08
80 0.11
81 0.14
82 0.16
83 0.19
84 0.23
85 0.29
86 0.33
87 0.31
88 0.3
89 0.27
90 0.26
91 0.25
92 0.21
93 0.16
94 0.15
95 0.15
96 0.15
97 0.15
98 0.15
99 0.15
100 0.16
101 0.22
102 0.22
103 0.24
104 0.24
105 0.25
106 0.25
107 0.25
108 0.24
109 0.18
110 0.12
111 0.12
112 0.14
113 0.14
114 0.15
115 0.14
116 0.14
117 0.17
118 0.19
119 0.19
120 0.2
121 0.26
122 0.34
123 0.44
124 0.52
125 0.59
126 0.68
127 0.76
128 0.85
129 0.89
130 0.9
131 0.92
132 0.92
133 0.93
134 0.91
135 0.9
136 0.83
137 0.77
138 0.69
139 0.62
140 0.54
141 0.45
142 0.36
143 0.27
144 0.23
145 0.2
146 0.18