Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2RS99

Protein Details
Accession A0A3M2RS99    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
46-71DESQCPKCEEEKKKKKEEEKEEEEEKAcidic
NLS Segment(s)
PositionSequence
57-61KKKKK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MCIVYRDQDICKKCDHLIYSREVETLCGSDRWGCNKHLLVSTLKVDESQCPKCEEEKKKKKEEEKEEEEEKEGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.36
3 0.35
4 0.35
5 0.39
6 0.39
7 0.37
8 0.36
9 0.3
10 0.27
11 0.21
12 0.18
13 0.14
14 0.11
15 0.1
16 0.13
17 0.15
18 0.19
19 0.21
20 0.2
21 0.23
22 0.24
23 0.25
24 0.23
25 0.24
26 0.2
27 0.2
28 0.2
29 0.18
30 0.16
31 0.15
32 0.14
33 0.17
34 0.22
35 0.24
36 0.24
37 0.26
38 0.28
39 0.34
40 0.43
41 0.48
42 0.53
43 0.6
44 0.68
45 0.75
46 0.83
47 0.86
48 0.87
49 0.87
50 0.86
51 0.83
52 0.82
53 0.77
54 0.7