Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1VRI8

Protein Details
Accession K1VRI8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
66-94VSEEQAKKDAKKRRREKDKARKAAKRAAEBasic
NLS Segment(s)
PositionSequence
72-91KKDAKKRRREKDKARKAAKR
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032704  Cms1  
Pfam View protein in Pfam  
PF14617  CMS1  
Amino Acid Sequences MSAEPKTGGDDLDDGLELDPSLMASDDEGAELGEDEGAYLSDEEEAPEPVSRKRKAADSADSAEPVSEEQAKKDAKKRRREKDKARKAAKRAAEYTEPADPSTLSTEEFAQTLLASLRSTFPAGTAMEIEDRAIPTKHLLPPLMAVDGEGSDPLKARLTDALRNAPKKPTMGTPRVLILSLSGIRCADVVRAVRDVPRPGGEIAKHFKVADQVKFLGKTRVAIAVGTPARVAKLLEEGALKITPQTVVILDIGHRDAKNRTMLSLPEVRDEFWKSLLANKARRALLDGGAHFAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.09
5 0.07
6 0.07
7 0.05
8 0.06
9 0.05
10 0.05
11 0.05
12 0.07
13 0.07
14 0.07
15 0.07
16 0.06
17 0.06
18 0.06
19 0.06
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.06
29 0.06
30 0.07
31 0.08
32 0.09
33 0.1
34 0.12
35 0.14
36 0.2
37 0.28
38 0.29
39 0.32
40 0.34
41 0.4
42 0.45
43 0.5
44 0.51
45 0.49
46 0.51
47 0.49
48 0.47
49 0.4
50 0.32
51 0.25
52 0.18
53 0.14
54 0.15
55 0.13
56 0.14
57 0.21
58 0.24
59 0.29
60 0.37
61 0.44
62 0.48
63 0.58
64 0.68
65 0.72
66 0.8
67 0.86
68 0.9
69 0.92
70 0.94
71 0.94
72 0.93
73 0.9
74 0.85
75 0.83
76 0.78
77 0.74
78 0.65
79 0.6
80 0.53
81 0.47
82 0.43
83 0.39
84 0.32
85 0.25
86 0.23
87 0.17
88 0.15
89 0.16
90 0.13
91 0.1
92 0.1
93 0.11
94 0.11
95 0.11
96 0.1
97 0.07
98 0.06
99 0.06
100 0.06
101 0.06
102 0.05
103 0.06
104 0.07
105 0.08
106 0.08
107 0.07
108 0.07
109 0.09
110 0.09
111 0.09
112 0.08
113 0.08
114 0.08
115 0.08
116 0.08
117 0.06
118 0.07
119 0.08
120 0.07
121 0.07
122 0.08
123 0.13
124 0.15
125 0.16
126 0.16
127 0.15
128 0.16
129 0.17
130 0.15
131 0.11
132 0.09
133 0.07
134 0.07
135 0.06
136 0.05
137 0.04
138 0.04
139 0.04
140 0.05
141 0.06
142 0.06
143 0.07
144 0.11
145 0.14
146 0.18
147 0.2
148 0.28
149 0.31
150 0.34
151 0.35
152 0.33
153 0.32
154 0.3
155 0.29
156 0.29
157 0.32
158 0.34
159 0.34
160 0.32
161 0.32
162 0.32
163 0.3
164 0.22
165 0.14
166 0.12
167 0.13
168 0.11
169 0.1
170 0.1
171 0.1
172 0.1
173 0.1
174 0.08
175 0.09
176 0.11
177 0.12
178 0.13
179 0.14
180 0.17
181 0.2
182 0.22
183 0.2
184 0.2
185 0.2
186 0.2
187 0.23
188 0.21
189 0.23
190 0.26
191 0.27
192 0.26
193 0.24
194 0.24
195 0.28
196 0.32
197 0.3
198 0.28
199 0.28
200 0.3
201 0.33
202 0.33
203 0.31
204 0.26
205 0.24
206 0.22
207 0.23
208 0.21
209 0.19
210 0.18
211 0.2
212 0.2
213 0.19
214 0.18
215 0.14
216 0.14
217 0.15
218 0.14
219 0.07
220 0.11
221 0.11
222 0.12
223 0.13
224 0.13
225 0.15
226 0.15
227 0.14
228 0.1
229 0.1
230 0.09
231 0.09
232 0.09
233 0.08
234 0.09
235 0.09
236 0.09
237 0.09
238 0.11
239 0.12
240 0.15
241 0.15
242 0.17
243 0.19
244 0.23
245 0.3
246 0.29
247 0.29
248 0.28
249 0.29
250 0.33
251 0.37
252 0.33
253 0.32
254 0.32
255 0.32
256 0.33
257 0.35
258 0.31
259 0.26
260 0.27
261 0.21
262 0.28
263 0.35
264 0.4
265 0.43
266 0.47
267 0.53
268 0.52
269 0.52
270 0.5
271 0.45
272 0.42
273 0.42
274 0.36
275 0.33