Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2QLB0

Protein Details
Accession A0A3M2QLB0    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MAQRLRRPNVWSRHRQCRQFAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MAQRLRRPNVWSRHRQCRQFAGLPQWTHLRQRTVARLDPQSPAYQAAGDESPGYQDERNNYGEGFVGDYGDGLVGDYSEENACQNHPELEQCMNQVIEIAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.79
4 0.77
5 0.75
6 0.7
7 0.66
8 0.64
9 0.62
10 0.55
11 0.52
12 0.48
13 0.43
14 0.42
15 0.41
16 0.36
17 0.33
18 0.37
19 0.43
20 0.42
21 0.45
22 0.44
23 0.44
24 0.42
25 0.4
26 0.37
27 0.3
28 0.26
29 0.22
30 0.18
31 0.14
32 0.12
33 0.11
34 0.09
35 0.08
36 0.07
37 0.06
38 0.06
39 0.06
40 0.08
41 0.07
42 0.08
43 0.11
44 0.14
45 0.15
46 0.15
47 0.15
48 0.14
49 0.14
50 0.12
51 0.11
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.05
58 0.05
59 0.03
60 0.03
61 0.03
62 0.03
63 0.04
64 0.05
65 0.05
66 0.06
67 0.06
68 0.07
69 0.08
70 0.1
71 0.11
72 0.12
73 0.13
74 0.16
75 0.18
76 0.21
77 0.22
78 0.22
79 0.23
80 0.21
81 0.2