Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1V3A4

Protein Details
Accession K1V3A4    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
16-39GRKNTGLTKKGKRNCAPKKAMASKHydrophilic
NLS Segment(s)
PositionSequence
7-39KLKAAKTSGGRKNTGLTKKGKRNCAPKKAMASK
Subcellular Location(s) nucl 14.5, mito_nucl 10.5, cyto 7, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGAGKLKAAKTSGGRKNTGLTKKGKRNCAPKKAMASKEYMTKKKGWVHGDAVERRKATQVFDQHMVTNPLTSARFDEVYTIELHWNSKTMCDPSADRLKPILALSSQDILPELLQLHNPPEYPADPRRSRPRSTPTLSGRW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.49
3 0.51
4 0.48
5 0.53
6 0.57
7 0.57
8 0.54
9 0.54
10 0.58
11 0.66
12 0.72
13 0.75
14 0.74
15 0.78
16 0.82
17 0.83
18 0.8
19 0.77
20 0.8
21 0.79
22 0.77
23 0.68
24 0.62
25 0.54
26 0.55
27 0.56
28 0.51
29 0.45
30 0.42
31 0.46
32 0.47
33 0.52
34 0.47
35 0.43
36 0.42
37 0.45
38 0.5
39 0.5
40 0.47
41 0.44
42 0.4
43 0.37
44 0.36
45 0.31
46 0.26
47 0.26
48 0.28
49 0.28
50 0.3
51 0.3
52 0.27
53 0.28
54 0.28
55 0.21
56 0.16
57 0.12
58 0.11
59 0.1
60 0.1
61 0.1
62 0.09
63 0.1
64 0.1
65 0.11
66 0.1
67 0.11
68 0.11
69 0.1
70 0.1
71 0.09
72 0.1
73 0.09
74 0.11
75 0.1
76 0.1
77 0.12
78 0.13
79 0.13
80 0.15
81 0.16
82 0.21
83 0.31
84 0.3
85 0.28
86 0.28
87 0.27
88 0.27
89 0.25
90 0.21
91 0.12
92 0.14
93 0.15
94 0.16
95 0.15
96 0.13
97 0.14
98 0.12
99 0.11
100 0.1
101 0.09
102 0.08
103 0.09
104 0.1
105 0.12
106 0.14
107 0.14
108 0.14
109 0.16
110 0.17
111 0.23
112 0.29
113 0.36
114 0.4
115 0.48
116 0.58
117 0.61
118 0.65
119 0.68
120 0.7
121 0.7
122 0.72
123 0.73