Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2RYC1

Protein Details
Accession A0A3M2RYC1    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MTQPRHSRRPKIQAGKLSFEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 10.5, mito 8, cyto 4
Family & Domain DBs
Amino Acid Sequences MTQPRHSRRPKIQAGKLSFEPFNFDSRPFYLAKFSNSSASIAFQAHRTSINPPQTLPPATNCQHQQRSKMACGTSSLVNRNGPGSAATSIAESILKPAEATGTKTKCIECGDYECCCIPCTIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.72
4 0.66
5 0.56
6 0.46
7 0.44
8 0.35
9 0.34
10 0.28
11 0.25
12 0.24
13 0.24
14 0.27
15 0.22
16 0.21
17 0.22
18 0.23
19 0.26
20 0.26
21 0.25
22 0.26
23 0.26
24 0.26
25 0.2
26 0.19
27 0.17
28 0.14
29 0.14
30 0.12
31 0.12
32 0.11
33 0.12
34 0.12
35 0.15
36 0.21
37 0.26
38 0.25
39 0.25
40 0.27
41 0.29
42 0.29
43 0.26
44 0.22
45 0.22
46 0.22
47 0.26
48 0.27
49 0.31
50 0.38
51 0.39
52 0.41
53 0.42
54 0.45
55 0.43
56 0.43
57 0.37
58 0.29
59 0.29
60 0.27
61 0.24
62 0.23
63 0.23
64 0.22
65 0.22
66 0.22
67 0.21
68 0.19
69 0.15
70 0.12
71 0.12
72 0.1
73 0.1
74 0.1
75 0.09
76 0.09
77 0.09
78 0.09
79 0.06
80 0.07
81 0.07
82 0.07
83 0.06
84 0.07
85 0.1
86 0.11
87 0.17
88 0.24
89 0.26
90 0.28
91 0.31
92 0.31
93 0.31
94 0.33
95 0.32
96 0.27
97 0.31
98 0.34
99 0.34
100 0.37
101 0.35
102 0.33
103 0.3