Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LHG9

Protein Details
Accession E2LHG9   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKKVRSAKPKIKSPSKDIDKBasic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 13, mito 11.5
Family & Domain DBs
KEGG mpr:MPER_05947  -  
Amino Acid Sequences MKKVRSAKPKIKSPSKDIDKESGVGGVAGSMRGLWSGNVLLVARLRERIAEREREREREREREMEDKEKSDGGAGLLSDEKTDKKGGVVHSDGDTECNDRPGLRRSHTIQHEKTDGRSTEEEGGSGAGIWGMGTSRVRGKIESWTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.78
4 0.72
5 0.68
6 0.6
7 0.54
8 0.47
9 0.37
10 0.28
11 0.2
12 0.16
13 0.1
14 0.07
15 0.06
16 0.06
17 0.04
18 0.04
19 0.05
20 0.05
21 0.04
22 0.05
23 0.06
24 0.06
25 0.07
26 0.07
27 0.07
28 0.09
29 0.1
30 0.09
31 0.11
32 0.11
33 0.12
34 0.14
35 0.21
36 0.24
37 0.33
38 0.35
39 0.43
40 0.47
41 0.52
42 0.53
43 0.55
44 0.55
45 0.54
46 0.55
47 0.51
48 0.51
49 0.5
50 0.5
51 0.49
52 0.45
53 0.38
54 0.35
55 0.3
56 0.26
57 0.2
58 0.16
59 0.09
60 0.08
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.08
70 0.08
71 0.08
72 0.12
73 0.13
74 0.17
75 0.18
76 0.18
77 0.18
78 0.2
79 0.19
80 0.17
81 0.16
82 0.13
83 0.12
84 0.12
85 0.12
86 0.11
87 0.15
88 0.2
89 0.25
90 0.26
91 0.31
92 0.34
93 0.43
94 0.51
95 0.57
96 0.54
97 0.54
98 0.57
99 0.53
100 0.52
101 0.5
102 0.43
103 0.39
104 0.37
105 0.34
106 0.34
107 0.32
108 0.29
109 0.22
110 0.21
111 0.15
112 0.14
113 0.11
114 0.04
115 0.04
116 0.04
117 0.04
118 0.04
119 0.06
120 0.07
121 0.1
122 0.15
123 0.2
124 0.22
125 0.23
126 0.24