Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2SAD9

Protein Details
Accession A0A3M2SAD9    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
335-356RIERLRAKGWERKRFNARRYEEBasic
NLS Segment(s)
PositionSequence
184-188PKRKK
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MSMRQETCRASAAEPKSLDYLPQSLSESLHGMPLTSDEWSKAIADVKREYLNRRYRPCATRCCEILDNIKDSSVIEPAYLIYLHFYAASSLEMLARALNQGSATRTSLLHQARDHYQRASALINAADSAVGPALLRRPSGTTTTLPSLHSADSSVSSYASSTWTSSHGASPASSISSIQDTPRPKRKKRVTFSEMPIELLERPDSPTLGLGSLLGSVRSASPDPLDVDSPVMPAPLRPSAPLPRSCLTPRSAPAESVSYSDSELDPFRHARSVHRYSALLTSLQRQVFRHLTFIESELLETATQEAVPPSPVSVMVVHPVHPSIDAGRSPELQARIERLRAKGWERKRFNARRYEELRESAVADLVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.37
4 0.35
5 0.34
6 0.28
7 0.28
8 0.22
9 0.23
10 0.24
11 0.22
12 0.22
13 0.22
14 0.21
15 0.18
16 0.2
17 0.17
18 0.14
19 0.13
20 0.14
21 0.13
22 0.13
23 0.13
24 0.11
25 0.12
26 0.12
27 0.13
28 0.13
29 0.18
30 0.19
31 0.24
32 0.26
33 0.29
34 0.35
35 0.38
36 0.42
37 0.45
38 0.53
39 0.57
40 0.61
41 0.64
42 0.67
43 0.73
44 0.75
45 0.76
46 0.71
47 0.69
48 0.63
49 0.63
50 0.56
51 0.51
52 0.52
53 0.46
54 0.43
55 0.37
56 0.35
57 0.28
58 0.27
59 0.24
60 0.17
61 0.12
62 0.09
63 0.09
64 0.09
65 0.1
66 0.09
67 0.08
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.06
74 0.07
75 0.07
76 0.06
77 0.06
78 0.07
79 0.07
80 0.07
81 0.06
82 0.06
83 0.07
84 0.06
85 0.06
86 0.07
87 0.08
88 0.1
89 0.12
90 0.13
91 0.13
92 0.13
93 0.14
94 0.22
95 0.23
96 0.25
97 0.24
98 0.26
99 0.32
100 0.37
101 0.38
102 0.31
103 0.31
104 0.27
105 0.28
106 0.25
107 0.19
108 0.15
109 0.13
110 0.12
111 0.1
112 0.09
113 0.07
114 0.06
115 0.05
116 0.04
117 0.03
118 0.03
119 0.04
120 0.07
121 0.08
122 0.09
123 0.09
124 0.11
125 0.13
126 0.16
127 0.19
128 0.17
129 0.19
130 0.22
131 0.23
132 0.21
133 0.21
134 0.2
135 0.17
136 0.15
137 0.13
138 0.1
139 0.1
140 0.1
141 0.09
142 0.08
143 0.07
144 0.07
145 0.07
146 0.08
147 0.07
148 0.07
149 0.07
150 0.09
151 0.11
152 0.11
153 0.11
154 0.11
155 0.11
156 0.11
157 0.11
158 0.09
159 0.08
160 0.07
161 0.07
162 0.06
163 0.08
164 0.08
165 0.08
166 0.13
167 0.17
168 0.23
169 0.33
170 0.42
171 0.44
172 0.55
173 0.64
174 0.7
175 0.74
176 0.78
177 0.75
178 0.75
179 0.74
180 0.72
181 0.62
182 0.52
183 0.44
184 0.34
185 0.27
186 0.2
187 0.16
188 0.08
189 0.1
190 0.09
191 0.09
192 0.09
193 0.09
194 0.09
195 0.08
196 0.07
197 0.06
198 0.05
199 0.06
200 0.06
201 0.05
202 0.05
203 0.05
204 0.05
205 0.07
206 0.07
207 0.07
208 0.07
209 0.09
210 0.1
211 0.11
212 0.12
213 0.1
214 0.11
215 0.11
216 0.11
217 0.1
218 0.09
219 0.07
220 0.07
221 0.1
222 0.11
223 0.12
224 0.12
225 0.16
226 0.24
227 0.29
228 0.33
229 0.35
230 0.33
231 0.37
232 0.39
233 0.38
234 0.34
235 0.33
236 0.32
237 0.33
238 0.33
239 0.29
240 0.29
241 0.28
242 0.26
243 0.22
244 0.2
245 0.14
246 0.14
247 0.14
248 0.12
249 0.11
250 0.11
251 0.11
252 0.14
253 0.15
254 0.16
255 0.19
256 0.19
257 0.25
258 0.33
259 0.38
260 0.39
261 0.4
262 0.4
263 0.37
264 0.4
265 0.35
266 0.27
267 0.22
268 0.23
269 0.26
270 0.28
271 0.28
272 0.25
273 0.3
274 0.35
275 0.35
276 0.34
277 0.28
278 0.28
279 0.27
280 0.28
281 0.24
282 0.17
283 0.16
284 0.13
285 0.13
286 0.11
287 0.1
288 0.09
289 0.07
290 0.07
291 0.07
292 0.08
293 0.08
294 0.09
295 0.09
296 0.09
297 0.09
298 0.09
299 0.1
300 0.11
301 0.11
302 0.15
303 0.16
304 0.17
305 0.17
306 0.18
307 0.17
308 0.16
309 0.16
310 0.13
311 0.16
312 0.16
313 0.19
314 0.21
315 0.22
316 0.23
317 0.27
318 0.28
319 0.26
320 0.28
321 0.31
322 0.33
323 0.38
324 0.42
325 0.39
326 0.42
327 0.46
328 0.51
329 0.54
330 0.6
331 0.64
332 0.66
333 0.73
334 0.79
335 0.82
336 0.83
337 0.84
338 0.79
339 0.79
340 0.78
341 0.78
342 0.73
343 0.67
344 0.62
345 0.53
346 0.48
347 0.38