Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VLM8

Protein Details
Accession K1VLM8   
Localization Confidence Medium
Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
254-279LPDTPAERKGSRRRSKRKIDDTALTVHydrophilic
NLS Segment(s)
PositionSequence
261-271RKGSRRRSKRK
Subcellular Location(s) mito 17, nucl 6.5, cyto_nucl 5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MKLLQRSRPAKPLPPFDGSQGLPVRNLIALAELRMEAEPGYYRTSARKIAYLTSSFTGRAGLWVSNQYRESLGADPIFKAYEEFKRMLLCYFDSSDTKLGQVIHCKQEGCVDEYAERWSRAIADLEDDVRRQSEILVFFTDQQGKLRRSVVQKQSLQIDANLRYWRLWWVYGLDAEIQAAVLADFHRLRFFEDVVMRAITLEQQLTSGAPTLVEKKQRRTTARMSDLVSWVAVRLDRAPSARKKGDSFVAIEDLPDTPAERKGSRRRSKRKIDDTALTVHPTRKPSEVVPLLHTETRYAPGSNSSYTTLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.61
3 0.55
4 0.55
5 0.46
6 0.45
7 0.4
8 0.35
9 0.31
10 0.3
11 0.27
12 0.21
13 0.2
14 0.13
15 0.11
16 0.11
17 0.11
18 0.12
19 0.1
20 0.11
21 0.11
22 0.12
23 0.08
24 0.09
25 0.11
26 0.11
27 0.15
28 0.15
29 0.16
30 0.21
31 0.25
32 0.3
33 0.29
34 0.31
35 0.29
36 0.33
37 0.37
38 0.35
39 0.34
40 0.29
41 0.29
42 0.25
43 0.24
44 0.21
45 0.15
46 0.15
47 0.13
48 0.12
49 0.12
50 0.19
51 0.21
52 0.24
53 0.24
54 0.24
55 0.22
56 0.23
57 0.23
58 0.18
59 0.19
60 0.17
61 0.17
62 0.17
63 0.17
64 0.16
65 0.13
66 0.13
67 0.13
68 0.18
69 0.21
70 0.21
71 0.22
72 0.23
73 0.24
74 0.24
75 0.22
76 0.18
77 0.17
78 0.18
79 0.19
80 0.18
81 0.2
82 0.2
83 0.18
84 0.17
85 0.16
86 0.15
87 0.15
88 0.22
89 0.25
90 0.27
91 0.28
92 0.28
93 0.27
94 0.31
95 0.31
96 0.26
97 0.22
98 0.19
99 0.18
100 0.18
101 0.22
102 0.19
103 0.17
104 0.14
105 0.13
106 0.13
107 0.13
108 0.14
109 0.1
110 0.1
111 0.1
112 0.12
113 0.13
114 0.12
115 0.11
116 0.1
117 0.1
118 0.08
119 0.08
120 0.09
121 0.1
122 0.11
123 0.13
124 0.13
125 0.13
126 0.16
127 0.17
128 0.14
129 0.16
130 0.21
131 0.2
132 0.22
133 0.23
134 0.26
135 0.3
136 0.38
137 0.42
138 0.45
139 0.46
140 0.45
141 0.46
142 0.43
143 0.37
144 0.3
145 0.26
146 0.2
147 0.21
148 0.2
149 0.18
150 0.16
151 0.16
152 0.17
153 0.15
154 0.13
155 0.1
156 0.11
157 0.12
158 0.12
159 0.12
160 0.1
161 0.08
162 0.08
163 0.07
164 0.05
165 0.04
166 0.04
167 0.03
168 0.03
169 0.03
170 0.06
171 0.06
172 0.07
173 0.08
174 0.08
175 0.1
176 0.12
177 0.12
178 0.14
179 0.15
180 0.16
181 0.16
182 0.16
183 0.14
184 0.12
185 0.12
186 0.09
187 0.08
188 0.07
189 0.06
190 0.06
191 0.06
192 0.06
193 0.07
194 0.07
195 0.06
196 0.06
197 0.07
198 0.11
199 0.15
200 0.24
201 0.28
202 0.35
203 0.44
204 0.51
205 0.56
206 0.58
207 0.64
208 0.65
209 0.67
210 0.63
211 0.57
212 0.52
213 0.49
214 0.42
215 0.33
216 0.22
217 0.16
218 0.13
219 0.11
220 0.09
221 0.09
222 0.11
223 0.13
224 0.16
225 0.23
226 0.29
227 0.37
228 0.42
229 0.44
230 0.44
231 0.46
232 0.49
233 0.44
234 0.39
235 0.33
236 0.31
237 0.27
238 0.24
239 0.21
240 0.16
241 0.14
242 0.12
243 0.11
244 0.09
245 0.14
246 0.18
247 0.2
248 0.29
249 0.39
250 0.5
251 0.59
252 0.69
253 0.75
254 0.82
255 0.9
256 0.92
257 0.93
258 0.92
259 0.89
260 0.84
261 0.77
262 0.72
263 0.63
264 0.56
265 0.48
266 0.42
267 0.39
268 0.36
269 0.35
270 0.33
271 0.33
272 0.32
273 0.39
274 0.42
275 0.4
276 0.4
277 0.42
278 0.43
279 0.43
280 0.41
281 0.33
282 0.28
283 0.3
284 0.28
285 0.24
286 0.21
287 0.25
288 0.28
289 0.28
290 0.29