Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1V3K4

Protein Details
Accession K1V3K4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
157-178PSPGTLQAQNKSRKNKHRKSRKHydrophilic
NLS Segment(s)
PositionSequence
167-178KSRKNKHRKSRK
Subcellular Location(s) mito 15.5, cyto_mito 10, nucl 7, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MASPPKVGFLAPVPRTNVQANVLRTATSAGIIADFQVRKSKIKAYYDYLRNGAPYDLTPEQLADIDLHQRIAMSELNEELDWKIASIYMDSGLPHLLEPAPTTEAAQMAAQAEQPQLQEQARRGKQPDKEPASHPKNMLPTVAFPAIGMDAKSDLNPSPGTLQAQNKSRKNKHRKSRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.41
3 0.41
4 0.38
5 0.32
6 0.35
7 0.33
8 0.33
9 0.32
10 0.29
11 0.27
12 0.25
13 0.21
14 0.14
15 0.12
16 0.08
17 0.08
18 0.07
19 0.08
20 0.11
21 0.11
22 0.12
23 0.19
24 0.21
25 0.23
26 0.26
27 0.32
28 0.35
29 0.41
30 0.45
31 0.44
32 0.52
33 0.55
34 0.55
35 0.5
36 0.43
37 0.37
38 0.34
39 0.27
40 0.18
41 0.13
42 0.16
43 0.15
44 0.15
45 0.14
46 0.13
47 0.13
48 0.12
49 0.13
50 0.07
51 0.07
52 0.09
53 0.09
54 0.09
55 0.09
56 0.08
57 0.08
58 0.09
59 0.1
60 0.08
61 0.08
62 0.08
63 0.09
64 0.09
65 0.09
66 0.08
67 0.07
68 0.06
69 0.06
70 0.06
71 0.05
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.05
78 0.06
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.05
86 0.06
87 0.07
88 0.07
89 0.08
90 0.08
91 0.08
92 0.08
93 0.08
94 0.07
95 0.06
96 0.07
97 0.06
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.1
104 0.11
105 0.14
106 0.17
107 0.27
108 0.29
109 0.34
110 0.37
111 0.41
112 0.47
113 0.53
114 0.59
115 0.56
116 0.57
117 0.57
118 0.64
119 0.63
120 0.61
121 0.53
122 0.47
123 0.46
124 0.43
125 0.4
126 0.31
127 0.27
128 0.28
129 0.27
130 0.22
131 0.16
132 0.16
133 0.15
134 0.15
135 0.13
136 0.08
137 0.09
138 0.1
139 0.1
140 0.11
141 0.11
142 0.13
143 0.13
144 0.14
145 0.15
146 0.17
147 0.2
148 0.24
149 0.31
150 0.35
151 0.43
152 0.51
153 0.57
154 0.65
155 0.72
156 0.77
157 0.81
158 0.85