Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SK01

Protein Details
Accession A0A3M2SK01    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
75-99APSVPVKKATPRKRKVNKKVVDSEDHydrophilic
NLS Segment(s)
PositionSequence
81-92KKATPRKRKVNK
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001005  SANT/Myb  
CDD cd00167  SANT  
Amino Acid Sequences MAEGAATGKANAWTEEAKNEFLLRIIMQLKPEGKGINWSEIQMPGRTVKSLQNQWTAVNKKIDAIRQQQQDGGDAPSVPVKKATPRKRKVNKKVVDSEDDDDGTYVGPKKSGSRKRANTETPERAAKAIKAEAAELEDFQVKDEPAFEADSEHGQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.24
3 0.25
4 0.24
5 0.23
6 0.23
7 0.21
8 0.18
9 0.18
10 0.13
11 0.15
12 0.15
13 0.16
14 0.16
15 0.21
16 0.21
17 0.21
18 0.23
19 0.19
20 0.17
21 0.24
22 0.25
23 0.26
24 0.25
25 0.24
26 0.24
27 0.27
28 0.28
29 0.21
30 0.2
31 0.18
32 0.18
33 0.18
34 0.18
35 0.21
36 0.26
37 0.32
38 0.35
39 0.37
40 0.37
41 0.39
42 0.46
43 0.43
44 0.4
45 0.36
46 0.32
47 0.29
48 0.31
49 0.32
50 0.3
51 0.33
52 0.36
53 0.36
54 0.36
55 0.35
56 0.33
57 0.31
58 0.26
59 0.21
60 0.14
61 0.1
62 0.1
63 0.11
64 0.11
65 0.1
66 0.1
67 0.09
68 0.17
69 0.27
70 0.37
71 0.45
72 0.53
73 0.65
74 0.74
75 0.85
76 0.88
77 0.88
78 0.85
79 0.82
80 0.83
81 0.76
82 0.7
83 0.62
84 0.53
85 0.44
86 0.38
87 0.29
88 0.2
89 0.16
90 0.11
91 0.1
92 0.1
93 0.08
94 0.09
95 0.1
96 0.16
97 0.26
98 0.35
99 0.42
100 0.51
101 0.59
102 0.67
103 0.75
104 0.76
105 0.74
106 0.75
107 0.73
108 0.67
109 0.62
110 0.55
111 0.48
112 0.43
113 0.36
114 0.31
115 0.26
116 0.24
117 0.2
118 0.2
119 0.19
120 0.19
121 0.18
122 0.14
123 0.14
124 0.15
125 0.14
126 0.15
127 0.17
128 0.15
129 0.14
130 0.15
131 0.15
132 0.13
133 0.15
134 0.13
135 0.13
136 0.14