Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2S0C4

Protein Details
Accession A0A3M2S0C4    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-42ATDGIDKARRLRRKRKAETQDNERLSKHydrophilic
NLS Segment(s)
PositionSequence
22-31KARRLRRKRK
Subcellular Location(s) nucl 22.5, cyto_nucl 15, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046591  DUF6649  
Pfam View protein in Pfam  
PF20354  DUF6649  
Amino Acid Sequences MLHGAQSPSTSAAPVATDGIDKARRLRRKRKAETQDNERLSKRLSLLNIEQSGSKLYVPVEEPSIPTPSIPNVAPSSSSSAPDLPVPNDSMQLDDSKHKVYIYNIDDELSSDSESDDPGKLVFLSDIEKHLRVNRIPPAVLANSEGELAGMQLVLYSDPKSLTVPEDKDSVRKAIIESRHRTREQQRLEREGKTNTPIVDSDSTNDAIVPPTYTDDDPDAMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.09
4 0.1
5 0.1
6 0.16
7 0.19
8 0.19
9 0.26
10 0.34
11 0.44
12 0.53
13 0.64
14 0.69
15 0.76
16 0.85
17 0.88
18 0.9
19 0.91
20 0.91
21 0.89
22 0.89
23 0.83
24 0.78
25 0.68
26 0.59
27 0.5
28 0.44
29 0.37
30 0.31
31 0.28
32 0.28
33 0.31
34 0.36
35 0.35
36 0.32
37 0.3
38 0.26
39 0.27
40 0.21
41 0.17
42 0.11
43 0.1
44 0.11
45 0.13
46 0.13
47 0.14
48 0.14
49 0.16
50 0.16
51 0.19
52 0.16
53 0.15
54 0.15
55 0.13
56 0.15
57 0.13
58 0.14
59 0.13
60 0.14
61 0.15
62 0.15
63 0.2
64 0.18
65 0.19
66 0.17
67 0.16
68 0.16
69 0.18
70 0.18
71 0.13
72 0.13
73 0.14
74 0.13
75 0.15
76 0.14
77 0.12
78 0.12
79 0.12
80 0.12
81 0.12
82 0.14
83 0.14
84 0.14
85 0.13
86 0.14
87 0.14
88 0.2
89 0.2
90 0.21
91 0.2
92 0.2
93 0.19
94 0.19
95 0.19
96 0.11
97 0.09
98 0.07
99 0.07
100 0.06
101 0.07
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.07
113 0.1
114 0.11
115 0.12
116 0.13
117 0.16
118 0.2
119 0.19
120 0.23
121 0.26
122 0.27
123 0.26
124 0.26
125 0.26
126 0.22
127 0.22
128 0.19
129 0.14
130 0.11
131 0.11
132 0.11
133 0.07
134 0.06
135 0.06
136 0.04
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.05
143 0.05
144 0.06
145 0.07
146 0.08
147 0.08
148 0.09
149 0.12
150 0.17
151 0.19
152 0.2
153 0.24
154 0.24
155 0.27
156 0.29
157 0.27
158 0.22
159 0.21
160 0.21
161 0.23
162 0.32
163 0.37
164 0.42
165 0.49
166 0.56
167 0.57
168 0.63
169 0.65
170 0.66
171 0.67
172 0.7
173 0.69
174 0.7
175 0.73
176 0.71
177 0.67
178 0.63
179 0.57
180 0.51
181 0.47
182 0.38
183 0.36
184 0.31
185 0.31
186 0.29
187 0.25
188 0.24
189 0.23
190 0.23
191 0.21
192 0.2
193 0.16
194 0.15
195 0.14
196 0.13
197 0.11
198 0.13
199 0.17
200 0.17
201 0.19
202 0.2
203 0.2
204 0.19