Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2RDK1

Protein Details
Accession A0A3M2RDK1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
53-73QPELRLKWRPHRYGRISEPNLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MMKSLSLNIFIPYRQALSCRTGLAVVVELQDVVHYATMKPPSTRILTPTNRYQPELRLKWRPHRYGRISEPNLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.2
5 0.21
6 0.2
7 0.19
8 0.17
9 0.16
10 0.15
11 0.13
12 0.09
13 0.08
14 0.07
15 0.07
16 0.06
17 0.06
18 0.05
19 0.04
20 0.05
21 0.04
22 0.05
23 0.08
24 0.11
25 0.12
26 0.12
27 0.13
28 0.15
29 0.18
30 0.19
31 0.2
32 0.27
33 0.31
34 0.36
35 0.43
36 0.48
37 0.47
38 0.49
39 0.47
40 0.46
41 0.51
42 0.53
43 0.52
44 0.53
45 0.58
46 0.66
47 0.74
48 0.76
49 0.75
50 0.78
51 0.79
52 0.79
53 0.82
54 0.82
55 0.77