Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2S368

Protein Details
Accession A0A3M2S368    Localization Confidence High Confidence Score 16.9
NoLS Segment(s)
PositionSequenceProtein Nature
98-120NGNDRPPRPVRIRPRPQRSTLWSHydrophilic
NLS Segment(s)
PositionSequence
57-73DKRAPRPVRIKPAPKRA
108-111RIRP
Subcellular Location(s) nucl 18, cyto 4, mito 2, extr 2
Family & Domain DBs
Amino Acid Sequences MGCFCSKDSNASSAAAARSRVDNDLGLVSGAGRYSEQETYAGEFGGLPRRDRNDGNDKRAPRPVRIKPAPKRASVSQVKWKNPIDVRHEYAVPEPIPNGNDRPPRPVRIRPRPQRSTLWSVGWRSVKGDKKAAQKRGSVNDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.2
4 0.19
5 0.2
6 0.21
7 0.22
8 0.2
9 0.18
10 0.17
11 0.16
12 0.15
13 0.12
14 0.1
15 0.08
16 0.07
17 0.07
18 0.06
19 0.05
20 0.06
21 0.09
22 0.09
23 0.1
24 0.1
25 0.11
26 0.13
27 0.14
28 0.12
29 0.09
30 0.09
31 0.09
32 0.18
33 0.18
34 0.17
35 0.2
36 0.23
37 0.26
38 0.28
39 0.33
40 0.36
41 0.41
42 0.48
43 0.51
44 0.51
45 0.51
46 0.57
47 0.53
48 0.48
49 0.51
50 0.5
51 0.54
52 0.59
53 0.66
54 0.66
55 0.75
56 0.72
57 0.65
58 0.62
59 0.54
60 0.55
61 0.51
62 0.47
63 0.46
64 0.5
65 0.5
66 0.51
67 0.51
68 0.48
69 0.46
70 0.47
71 0.45
72 0.43
73 0.44
74 0.4
75 0.4
76 0.34
77 0.31
78 0.29
79 0.22
80 0.17
81 0.14
82 0.13
83 0.14
84 0.15
85 0.16
86 0.19
87 0.27
88 0.28
89 0.36
90 0.38
91 0.44
92 0.49
93 0.56
94 0.6
95 0.63
96 0.73
97 0.76
98 0.82
99 0.82
100 0.81
101 0.8
102 0.77
103 0.74
104 0.67
105 0.63
106 0.58
107 0.53
108 0.55
109 0.5
110 0.43
111 0.39
112 0.43
113 0.44
114 0.44
115 0.5
116 0.5
117 0.57
118 0.66
119 0.72
120 0.69
121 0.68
122 0.7
123 0.72