Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2RPS6

Protein Details
Accession A0A3M2RPS6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-84LWKIPWRLSKFQKRRHRLRLRAVDNHydrophilic
120-151DKYTMFDRKAKRYRKGIHKLPKWTRVSQRINPHydrophilic
NLS Segment(s)
PositionSequence
127-141RKAKRYRKGIHKLPK
Subcellular Location(s) mito 20.5, cyto_mito 11, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MPPYQAPAAPPAAPREKVHVGPPINVQLLLRPSSPIQRYPLPATMFGPFRITNPLSGGLLWKIPWRLSKFQKRRHRLRLRAVDNVVATVDAALAKKGHTLEALERWKAEMPTEAEMLPKDKYTMFDRKAKRYRKGIHKLPKWTRVSQRINPPGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.38
3 0.4
4 0.4
5 0.42
6 0.43
7 0.39
8 0.39
9 0.41
10 0.38
11 0.34
12 0.33
13 0.28
14 0.24
15 0.25
16 0.24
17 0.2
18 0.17
19 0.18
20 0.25
21 0.28
22 0.27
23 0.29
24 0.31
25 0.35
26 0.38
27 0.42
28 0.36
29 0.35
30 0.33
31 0.32
32 0.29
33 0.25
34 0.24
35 0.18
36 0.17
37 0.22
38 0.21
39 0.18
40 0.18
41 0.19
42 0.16
43 0.16
44 0.16
45 0.11
46 0.11
47 0.1
48 0.1
49 0.1
50 0.12
51 0.17
52 0.21
53 0.28
54 0.37
55 0.47
56 0.55
57 0.64
58 0.73
59 0.77
60 0.82
61 0.86
62 0.87
63 0.84
64 0.85
65 0.85
66 0.79
67 0.76
68 0.67
69 0.58
70 0.47
71 0.39
72 0.28
73 0.18
74 0.13
75 0.07
76 0.06
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.07
83 0.07
84 0.08
85 0.08
86 0.09
87 0.11
88 0.2
89 0.23
90 0.22
91 0.22
92 0.23
93 0.25
94 0.23
95 0.22
96 0.18
97 0.17
98 0.19
99 0.2
100 0.19
101 0.17
102 0.18
103 0.19
104 0.15
105 0.13
106 0.12
107 0.12
108 0.15
109 0.2
110 0.29
111 0.32
112 0.4
113 0.47
114 0.56
115 0.65
116 0.71
117 0.73
118 0.74
119 0.79
120 0.81
121 0.85
122 0.85
123 0.87
124 0.86
125 0.89
126 0.88
127 0.88
128 0.83
129 0.81
130 0.81
131 0.8
132 0.81
133 0.78
134 0.8