Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SB43

Protein Details
Accession A0A3M2SB43    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
37-56ATKFRGRRNVRRLRGNRPTVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 15, extr 5, mito 3, cyto 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTNSSVCATGLLGAISKEGWAGWAASLVIAILIASMATKFRGRRNVRRLRGNRPTVSVILCKRGEEPRRIPAVVIRED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.06
5 0.05
6 0.05
7 0.05
8 0.06
9 0.05
10 0.06
11 0.06
12 0.06
13 0.06
14 0.05
15 0.04
16 0.03
17 0.03
18 0.02
19 0.02
20 0.02
21 0.02
22 0.02
23 0.03
24 0.04
25 0.06
26 0.09
27 0.13
28 0.23
29 0.3
30 0.4
31 0.51
32 0.61
33 0.66
34 0.75
35 0.77
36 0.77
37 0.8
38 0.78
39 0.7
40 0.64
41 0.6
42 0.51
43 0.48
44 0.44
45 0.36
46 0.35
47 0.33
48 0.3
49 0.3
50 0.38
51 0.42
52 0.44
53 0.47
54 0.49
55 0.54
56 0.54
57 0.51
58 0.47