Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2S6B1

Protein Details
Accession A0A3M2S6B1    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-82SPIPIHPPTRRPPRKPRFRAREWRGRAVLBasic
NLS Segment(s)
PositionSequence
61-79PTRRPPRKPRFRAREWRGR
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 3
Family & Domain DBs
Amino Acid Sequences MLASLTVPTTRDVHHHGANATSASAPASQDPATSSGRRTRLRLCTSGIRVPLVSPIPIHPPTRRPPRKPRFRAREWRGRAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.3
4 0.29
5 0.29
6 0.26
7 0.2
8 0.15
9 0.11
10 0.09
11 0.09
12 0.08
13 0.08
14 0.1
15 0.09
16 0.09
17 0.1
18 0.13
19 0.15
20 0.15
21 0.17
22 0.21
23 0.28
24 0.3
25 0.32
26 0.35
27 0.41
28 0.44
29 0.44
30 0.41
31 0.41
32 0.43
33 0.43
34 0.38
35 0.3
36 0.25
37 0.23
38 0.23
39 0.18
40 0.14
41 0.11
42 0.12
43 0.17
44 0.21
45 0.24
46 0.23
47 0.29
48 0.38
49 0.49
50 0.58
51 0.61
52 0.69
53 0.77
54 0.86
55 0.9
56 0.92
57 0.9
58 0.91
59 0.93
60 0.91
61 0.91
62 0.88