Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2S834

Protein Details
Accession A0A3M2S834    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-29NSFVGKPINYHRRHRNLQRSSPQFRPPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 19, mito 5, nucl 1, cyto 1, cyto_nucl 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR008389  ATPase_V0-cplx_e1/e2_su  
Gene Ontology GO:0033179  C:proton-transporting V-type ATPase, V0 domain  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
Pfam View protein in Pfam  
PF05493  ATP_synt_H  
Amino Acid Sequences MNNSFVGKPINYHRRHRNLQRSSPQFRPPPSNRNLPNEALLPAGSSSTRLSIKKHKPANMAQGYAVFIGLVVIAALCVASWFLAPKGENQVLWRSSLILAIVSCYLMWAITFMAQLHPLIAPRRTGIREEYLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.76
3 0.82
4 0.83
5 0.83
6 0.87
7 0.88
8 0.87
9 0.84
10 0.8
11 0.78
12 0.74
13 0.68
14 0.68
15 0.64
16 0.64
17 0.63
18 0.66
19 0.63
20 0.64
21 0.64
22 0.55
23 0.51
24 0.43
25 0.38
26 0.29
27 0.23
28 0.16
29 0.12
30 0.1
31 0.08
32 0.07
33 0.07
34 0.09
35 0.13
36 0.14
37 0.17
38 0.27
39 0.36
40 0.43
41 0.49
42 0.51
43 0.54
44 0.57
45 0.64
46 0.57
47 0.49
48 0.41
49 0.35
50 0.31
51 0.25
52 0.2
53 0.09
54 0.05
55 0.04
56 0.04
57 0.03
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.01
64 0.02
65 0.02
66 0.02
67 0.02
68 0.03
69 0.04
70 0.06
71 0.07
72 0.09
73 0.15
74 0.16
75 0.16
76 0.18
77 0.24
78 0.22
79 0.23
80 0.22
81 0.16
82 0.16
83 0.16
84 0.14
85 0.09
86 0.08
87 0.08
88 0.08
89 0.07
90 0.07
91 0.06
92 0.06
93 0.05
94 0.05
95 0.04
96 0.05
97 0.06
98 0.07
99 0.07
100 0.08
101 0.09
102 0.1
103 0.1
104 0.1
105 0.13
106 0.16
107 0.18
108 0.18
109 0.2
110 0.26
111 0.28
112 0.3
113 0.32