Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VHE4

Protein Details
Accession K1VHE4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
49-69ITLKKATKKDAKKAGDNKKGGBasic
NLS Segment(s)
PositionSequence
52-72KKATKKDAKKAGDNKKGGKKK
Subcellular Location(s) mito 25.5, cyto_mito 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR002661  Ribosome_recyc_fac  
IPR023584  Ribosome_recyc_fac_dom  
IPR036191  RRF_sf  
Gene Ontology GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01765  RRF  
Amino Acid Sequences MRAAFRIARIAARAAPAPRAAAPRALPSPLPSSSVLATSSARAFSTTPITLKKATKKDAKKAGDNKKGGKKKAEVEVEETVMTDAQIDAIVKKANEKMNKSLDWAKSVLFEGVERGRGRVSPAVLDTVKVAIPDQGSQPLKAIASITVTKGGLLVEAWDSDTVKHVESALHKANLPGMSPQRDGDRIRLPVTRPDTSVRNEIVRSLGGTVEDAKNQMRQARSDGIKSVGGKNFRGADEIQSALERKSKELDEQLKTAKKELEKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.25
4 0.25
5 0.26
6 0.28
7 0.27
8 0.27
9 0.28
10 0.31
11 0.32
12 0.32
13 0.29
14 0.28
15 0.32
16 0.28
17 0.29
18 0.24
19 0.24
20 0.22
21 0.23
22 0.2
23 0.17
24 0.17
25 0.16
26 0.16
27 0.14
28 0.14
29 0.13
30 0.13
31 0.14
32 0.18
33 0.18
34 0.2
35 0.22
36 0.25
37 0.29
38 0.35
39 0.42
40 0.44
41 0.51
42 0.58
43 0.63
44 0.69
45 0.75
46 0.74
47 0.75
48 0.78
49 0.8
50 0.8
51 0.78
52 0.77
53 0.77
54 0.78
55 0.73
56 0.7
57 0.65
58 0.61
59 0.64
60 0.62
61 0.54
62 0.51
63 0.49
64 0.43
65 0.37
66 0.31
67 0.22
68 0.15
69 0.13
70 0.08
71 0.05
72 0.04
73 0.05
74 0.05
75 0.04
76 0.06
77 0.08
78 0.07
79 0.1
80 0.15
81 0.2
82 0.26
83 0.29
84 0.34
85 0.39
86 0.39
87 0.41
88 0.43
89 0.38
90 0.35
91 0.32
92 0.26
93 0.22
94 0.22
95 0.18
96 0.11
97 0.1
98 0.1
99 0.1
100 0.14
101 0.13
102 0.13
103 0.13
104 0.13
105 0.15
106 0.15
107 0.14
108 0.11
109 0.12
110 0.14
111 0.14
112 0.14
113 0.12
114 0.1
115 0.1
116 0.09
117 0.08
118 0.06
119 0.07
120 0.08
121 0.08
122 0.14
123 0.14
124 0.14
125 0.14
126 0.14
127 0.13
128 0.13
129 0.12
130 0.06
131 0.08
132 0.09
133 0.09
134 0.1
135 0.1
136 0.09
137 0.09
138 0.09
139 0.06
140 0.05
141 0.06
142 0.04
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.08
149 0.08
150 0.08
151 0.09
152 0.08
153 0.11
154 0.13
155 0.19
156 0.2
157 0.2
158 0.2
159 0.2
160 0.24
161 0.22
162 0.2
163 0.19
164 0.2
165 0.22
166 0.23
167 0.24
168 0.24
169 0.28
170 0.28
171 0.29
172 0.31
173 0.3
174 0.31
175 0.34
176 0.33
177 0.36
178 0.41
179 0.38
180 0.34
181 0.35
182 0.36
183 0.36
184 0.4
185 0.34
186 0.31
187 0.29
188 0.28
189 0.26
190 0.22
191 0.19
192 0.15
193 0.13
194 0.1
195 0.1
196 0.13
197 0.12
198 0.13
199 0.14
200 0.14
201 0.17
202 0.19
203 0.23
204 0.22
205 0.23
206 0.28
207 0.35
208 0.36
209 0.36
210 0.36
211 0.34
212 0.35
213 0.36
214 0.38
215 0.34
216 0.35
217 0.33
218 0.36
219 0.37
220 0.33
221 0.34
222 0.28
223 0.27
224 0.26
225 0.26
226 0.23
227 0.21
228 0.22
229 0.21
230 0.24
231 0.21
232 0.2
233 0.24
234 0.25
235 0.29
236 0.38
237 0.45
238 0.45
239 0.5
240 0.56
241 0.58
242 0.57
243 0.56
244 0.52