Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SJ14

Protein Details
Accession A0A3M2SJ14    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
62-87HSSVKKRCEHCKVVRRKAGKRHNGYLBasic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MASLFRTLSLSARSLSSRNVLGAFATRANWSMGALPSLFASPSAAPALGVGLMQQTRGMKVHSSVKKRCEHCKVVRRKAGKRHNGYLYIICKANPRHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.2
5 0.19
6 0.19
7 0.17
8 0.15
9 0.16
10 0.15
11 0.13
12 0.13
13 0.12
14 0.13
15 0.13
16 0.12
17 0.11
18 0.11
19 0.11
20 0.11
21 0.1
22 0.09
23 0.09
24 0.09
25 0.08
26 0.06
27 0.07
28 0.06
29 0.07
30 0.07
31 0.06
32 0.06
33 0.06
34 0.06
35 0.05
36 0.04
37 0.03
38 0.04
39 0.04
40 0.04
41 0.05
42 0.05
43 0.06
44 0.07
45 0.08
46 0.08
47 0.11
48 0.2
49 0.26
50 0.35
51 0.39
52 0.46
53 0.53
54 0.57
55 0.63
56 0.63
57 0.65
58 0.67
59 0.72
60 0.75
61 0.78
62 0.82
63 0.81
64 0.81
65 0.82
66 0.83
67 0.84
68 0.81
69 0.79
70 0.77
71 0.73
72 0.68
73 0.64
74 0.57
75 0.5
76 0.43
77 0.35
78 0.35
79 0.39
80 0.46
81 0.48
82 0.54