Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SI28

Protein Details
Accession A0A3M2SI28    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
252-278DTYFKWPSNPWPKDKKHKLLGQWNNINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12.5, cyto 8, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029063  SAM-dependent_MTases_sf  
Pfam View protein in Pfam  
PF13489  Methyltransf_23  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MCGPEEENTGPAVVPDDEVDTDGDSSYETDTASSTQSLSASILDYRRENGRTYHRYKDGKYAMPNDDIENERLDLQHHLFLYTLENKLGLAPPNERDANVKRVLDLGTGTGIWALDYADEHPEAEVIGIDLSPTQPEFVPPNVQFIVDDIDEEWSYSKPFDYIHSRMMNISVGNWNDYLRQIYDNLEPGGFVELQEVDIAMKSDDATLTPENKLAIWNKLLNSASEKMGRAMVTHKHIKDLMIEIGFTDIVDTYFKWPSNPWPKDKKHKLLGQWNNINTGYALEGAAMAPLTRIHGWSREEVTVLVAGARAELNNPAIHAYWPIVSIYAQRPKEGGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.12
5 0.13
6 0.13
7 0.11
8 0.11
9 0.11
10 0.1
11 0.08
12 0.09
13 0.09
14 0.09
15 0.08
16 0.08
17 0.09
18 0.1
19 0.11
20 0.11
21 0.1
22 0.11
23 0.11
24 0.11
25 0.11
26 0.11
27 0.1
28 0.13
29 0.15
30 0.17
31 0.18
32 0.2
33 0.25
34 0.27
35 0.27
36 0.31
37 0.39
38 0.46
39 0.5
40 0.57
41 0.6
42 0.64
43 0.65
44 0.68
45 0.65
46 0.62
47 0.63
48 0.61
49 0.56
50 0.54
51 0.52
52 0.43
53 0.4
54 0.36
55 0.3
56 0.25
57 0.22
58 0.18
59 0.17
60 0.17
61 0.16
62 0.16
63 0.18
64 0.16
65 0.16
66 0.15
67 0.16
68 0.19
69 0.19
70 0.18
71 0.15
72 0.14
73 0.14
74 0.15
75 0.17
76 0.16
77 0.15
78 0.16
79 0.18
80 0.23
81 0.24
82 0.23
83 0.26
84 0.27
85 0.31
86 0.33
87 0.32
88 0.27
89 0.28
90 0.28
91 0.23
92 0.19
93 0.13
94 0.09
95 0.09
96 0.09
97 0.07
98 0.06
99 0.05
100 0.05
101 0.04
102 0.03
103 0.04
104 0.05
105 0.06
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.06
112 0.05
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.04
121 0.05
122 0.05
123 0.06
124 0.09
125 0.1
126 0.16
127 0.16
128 0.2
129 0.19
130 0.2
131 0.18
132 0.16
133 0.17
134 0.11
135 0.11
136 0.07
137 0.08
138 0.08
139 0.08
140 0.09
141 0.06
142 0.07
143 0.07
144 0.07
145 0.06
146 0.06
147 0.1
148 0.16
149 0.18
150 0.24
151 0.25
152 0.25
153 0.25
154 0.25
155 0.22
156 0.15
157 0.14
158 0.11
159 0.1
160 0.11
161 0.11
162 0.1
163 0.1
164 0.11
165 0.11
166 0.08
167 0.09
168 0.09
169 0.11
170 0.12
171 0.13
172 0.13
173 0.12
174 0.11
175 0.1
176 0.11
177 0.09
178 0.08
179 0.06
180 0.06
181 0.06
182 0.06
183 0.06
184 0.04
185 0.04
186 0.05
187 0.04
188 0.04
189 0.04
190 0.04
191 0.04
192 0.05
193 0.08
194 0.09
195 0.11
196 0.12
197 0.12
198 0.12
199 0.12
200 0.16
201 0.15
202 0.16
203 0.17
204 0.19
205 0.19
206 0.24
207 0.24
208 0.21
209 0.24
210 0.23
211 0.22
212 0.22
213 0.22
214 0.18
215 0.2
216 0.19
217 0.15
218 0.17
219 0.2
220 0.23
221 0.3
222 0.3
223 0.31
224 0.32
225 0.31
226 0.3
227 0.28
228 0.25
229 0.18
230 0.17
231 0.14
232 0.14
233 0.13
234 0.11
235 0.08
236 0.05
237 0.05
238 0.06
239 0.07
240 0.09
241 0.13
242 0.13
243 0.14
244 0.16
245 0.26
246 0.36
247 0.42
248 0.48
249 0.55
250 0.63
251 0.74
252 0.83
253 0.82
254 0.8
255 0.81
256 0.81
257 0.81
258 0.83
259 0.82
260 0.79
261 0.71
262 0.66
263 0.59
264 0.5
265 0.39
266 0.3
267 0.2
268 0.13
269 0.11
270 0.07
271 0.07
272 0.06
273 0.07
274 0.06
275 0.05
276 0.05
277 0.05
278 0.08
279 0.08
280 0.1
281 0.12
282 0.18
283 0.21
284 0.25
285 0.29
286 0.27
287 0.27
288 0.26
289 0.25
290 0.2
291 0.17
292 0.13
293 0.1
294 0.09
295 0.08
296 0.09
297 0.07
298 0.08
299 0.1
300 0.12
301 0.12
302 0.12
303 0.13
304 0.14
305 0.14
306 0.15
307 0.14
308 0.13
309 0.14
310 0.13
311 0.13
312 0.12
313 0.17
314 0.24
315 0.32
316 0.32
317 0.32