Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2RP50

Protein Details
Accession A0A3M2RP50    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
4-29TVKASPPKVKAPKSESKNRKRSEESGHydrophilic
NLS Segment(s)
PositionSequence
10-24PKVKAPKSESKNRKR
Subcellular Location(s) plas 24, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGVTVKASPPKVKAPKSESKNRKRSEESGQGEAAPVGTNPGGYEEWLSRNTGSYNSSSSNTTLPPIPIEWNISPTNLTSAVCPTVEQTVGWFAATDVFSTLFSGFFVFIILMCRTSNRERNTSRGIRETKRLWFTWLIGFTFEALGNLANASIVIKTEYYENLALGHVFLVYSSRPRIKMWFYAIFRLLTSEGEYHITGAYFSMAIVEVMLHIMSAVFVGVTWSRYPNEPIKAYMSPVTVYMQVVPGILVLAILLAVPIWRRSKNPWQLPSHLWDFVLASVFFGVVYAASWAYWGMFLQLPGPLFCPPKILDHTVVWMIFSTMSSFFSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.7
3 0.74
4 0.81
5 0.82
6 0.83
7 0.86
8 0.83
9 0.84
10 0.81
11 0.78
12 0.77
13 0.77
14 0.7
15 0.65
16 0.6
17 0.5
18 0.44
19 0.38
20 0.28
21 0.18
22 0.12
23 0.1
24 0.09
25 0.08
26 0.08
27 0.11
28 0.11
29 0.11
30 0.13
31 0.13
32 0.17
33 0.18
34 0.19
35 0.16
36 0.18
37 0.19
38 0.19
39 0.19
40 0.18
41 0.2
42 0.21
43 0.22
44 0.22
45 0.23
46 0.22
47 0.21
48 0.21
49 0.2
50 0.18
51 0.18
52 0.18
53 0.19
54 0.18
55 0.23
56 0.21
57 0.23
58 0.23
59 0.22
60 0.21
61 0.19
62 0.2
63 0.16
64 0.15
65 0.12
66 0.13
67 0.14
68 0.14
69 0.13
70 0.12
71 0.13
72 0.13
73 0.12
74 0.1
75 0.11
76 0.11
77 0.11
78 0.1
79 0.08
80 0.11
81 0.11
82 0.1
83 0.08
84 0.09
85 0.09
86 0.1
87 0.1
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.08
97 0.08
98 0.08
99 0.08
100 0.09
101 0.13
102 0.2
103 0.27
104 0.28
105 0.36
106 0.38
107 0.44
108 0.51
109 0.53
110 0.5
111 0.51
112 0.54
113 0.49
114 0.53
115 0.51
116 0.5
117 0.48
118 0.46
119 0.41
120 0.36
121 0.34
122 0.32
123 0.3
124 0.23
125 0.19
126 0.18
127 0.15
128 0.14
129 0.12
130 0.07
131 0.06
132 0.05
133 0.05
134 0.05
135 0.04
136 0.03
137 0.03
138 0.03
139 0.03
140 0.03
141 0.04
142 0.04
143 0.04
144 0.05
145 0.06
146 0.07
147 0.08
148 0.08
149 0.08
150 0.08
151 0.07
152 0.06
153 0.06
154 0.04
155 0.03
156 0.03
157 0.04
158 0.04
159 0.06
160 0.08
161 0.11
162 0.12
163 0.13
164 0.17
165 0.19
166 0.23
167 0.27
168 0.33
169 0.32
170 0.34
171 0.34
172 0.31
173 0.28
174 0.25
175 0.2
176 0.12
177 0.12
178 0.09
179 0.09
180 0.1
181 0.1
182 0.09
183 0.09
184 0.08
185 0.07
186 0.06
187 0.06
188 0.04
189 0.04
190 0.04
191 0.04
192 0.04
193 0.04
194 0.03
195 0.03
196 0.03
197 0.03
198 0.03
199 0.02
200 0.03
201 0.02
202 0.02
203 0.02
204 0.02
205 0.02
206 0.03
207 0.04
208 0.06
209 0.07
210 0.09
211 0.1
212 0.11
213 0.16
214 0.21
215 0.26
216 0.26
217 0.27
218 0.3
219 0.3
220 0.31
221 0.29
222 0.25
223 0.19
224 0.19
225 0.18
226 0.14
227 0.14
228 0.13
229 0.11
230 0.1
231 0.1
232 0.09
233 0.07
234 0.06
235 0.05
236 0.04
237 0.03
238 0.03
239 0.02
240 0.02
241 0.02
242 0.02
243 0.03
244 0.04
245 0.08
246 0.12
247 0.14
248 0.17
249 0.25
250 0.36
251 0.46
252 0.55
253 0.6
254 0.63
255 0.66
256 0.68
257 0.66
258 0.6
259 0.5
260 0.41
261 0.33
262 0.27
263 0.22
264 0.22
265 0.15
266 0.11
267 0.1
268 0.1
269 0.09
270 0.08
271 0.07
272 0.04
273 0.04
274 0.05
275 0.05
276 0.05
277 0.05
278 0.05
279 0.06
280 0.06
281 0.06
282 0.07
283 0.09
284 0.09
285 0.1
286 0.12
287 0.13
288 0.13
289 0.15
290 0.17
291 0.19
292 0.19
293 0.22
294 0.21
295 0.27
296 0.32
297 0.36
298 0.36
299 0.34
300 0.39
301 0.38
302 0.36
303 0.3
304 0.24
305 0.2
306 0.16
307 0.15
308 0.13
309 0.1