Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2RYY4

Protein Details
Accession A0A3M2RYY4    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
242-265PSQIPGKGKKADRYKNRGPFWRGLHydrophilic
NLS Segment(s)
PositionSequence
249-254GKKADR
Subcellular Location(s) nucl 19, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR045030  LYSM1-4  
IPR018392  LysM_dom  
IPR036779  LysM_dom_sf  
Pfam View protein in Pfam  
PF14555  UBA_4  
CDD cd00118  LysM  
Amino Acid Sequences METCSTCATVLKSTPAYTEDELSPQDRRVQCCYRVICGKCIVKNERFANYCPYCQVSTVPSSLPQGLREPPAYTSWPSSSSRTADISGAPPPYTPATPRRLATTDVENEKAASADDGSKENVLDTLHFLDHRHDSVNSLSLRYGVPVTVLRRVNNITSDHLLVGRRTVLIPGEYYKGGVSLSPRPIEGEEEETRKAKIRRFMTSCKVSDYDVAVLYLEQSSYDLEAAVTAYLDDDKWERDHPSQIPGKGKKADRYKNRGPFWRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.29
4 0.26
5 0.27
6 0.23
7 0.23
8 0.25
9 0.26
10 0.26
11 0.23
12 0.3
13 0.31
14 0.34
15 0.39
16 0.44
17 0.47
18 0.53
19 0.54
20 0.53
21 0.57
22 0.55
23 0.52
24 0.53
25 0.55
26 0.5
27 0.56
28 0.56
29 0.52
30 0.58
31 0.58
32 0.57
33 0.54
34 0.52
35 0.53
36 0.49
37 0.46
38 0.39
39 0.38
40 0.31
41 0.29
42 0.29
43 0.22
44 0.22
45 0.22
46 0.2
47 0.18
48 0.2
49 0.22
50 0.21
51 0.2
52 0.2
53 0.21
54 0.24
55 0.24
56 0.23
57 0.21
58 0.23
59 0.24
60 0.22
61 0.23
62 0.22
63 0.24
64 0.25
65 0.26
66 0.27
67 0.26
68 0.27
69 0.25
70 0.24
71 0.21
72 0.2
73 0.19
74 0.18
75 0.18
76 0.15
77 0.13
78 0.14
79 0.15
80 0.15
81 0.16
82 0.19
83 0.24
84 0.27
85 0.28
86 0.3
87 0.3
88 0.32
89 0.31
90 0.31
91 0.3
92 0.29
93 0.3
94 0.26
95 0.24
96 0.22
97 0.19
98 0.13
99 0.08
100 0.06
101 0.06
102 0.07
103 0.08
104 0.09
105 0.09
106 0.09
107 0.08
108 0.09
109 0.07
110 0.07
111 0.07
112 0.08
113 0.08
114 0.08
115 0.09
116 0.1
117 0.12
118 0.12
119 0.12
120 0.11
121 0.12
122 0.12
123 0.17
124 0.15
125 0.14
126 0.13
127 0.13
128 0.13
129 0.12
130 0.11
131 0.06
132 0.07
133 0.09
134 0.11
135 0.16
136 0.18
137 0.18
138 0.2
139 0.21
140 0.22
141 0.22
142 0.22
143 0.19
144 0.19
145 0.19
146 0.17
147 0.17
148 0.17
149 0.14
150 0.13
151 0.11
152 0.1
153 0.09
154 0.09
155 0.09
156 0.08
157 0.09
158 0.1
159 0.12
160 0.11
161 0.12
162 0.11
163 0.1
164 0.09
165 0.09
166 0.11
167 0.15
168 0.18
169 0.19
170 0.19
171 0.2
172 0.2
173 0.22
174 0.21
175 0.21
176 0.21
177 0.23
178 0.26
179 0.25
180 0.25
181 0.29
182 0.31
183 0.3
184 0.35
185 0.37
186 0.45
187 0.51
188 0.58
189 0.6
190 0.65
191 0.61
192 0.57
193 0.53
194 0.44
195 0.4
196 0.35
197 0.28
198 0.2
199 0.19
200 0.14
201 0.13
202 0.13
203 0.11
204 0.08
205 0.06
206 0.06
207 0.06
208 0.07
209 0.07
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.05
216 0.04
217 0.05
218 0.05
219 0.06
220 0.07
221 0.08
222 0.11
223 0.13
224 0.16
225 0.21
226 0.23
227 0.31
228 0.31
229 0.39
230 0.43
231 0.47
232 0.54
233 0.55
234 0.59
235 0.61
236 0.65
237 0.65
238 0.69
239 0.74
240 0.74
241 0.78
242 0.81
243 0.83
244 0.86
245 0.86