Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

K1W5B8

Protein Details
Accession K1W5B8    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
50-71FFKAYRECKKNWQEQRKRDRSSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
Amino Acid Sequences MATPVPPNKNPTPKEYLPPPPTPEMKQPADYKKTLQAHKDHRVVSKCYEFFKAYRECKKNWQEQRKRDRSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.59
3 0.6
4 0.57
5 0.59
6 0.57
7 0.53
8 0.54
9 0.5
10 0.5
11 0.47
12 0.43
13 0.44
14 0.45
15 0.48
16 0.48
17 0.46
18 0.41
19 0.42
20 0.45
21 0.43
22 0.42
23 0.42
24 0.46
25 0.53
26 0.56
27 0.5
28 0.5
29 0.51
30 0.49
31 0.47
32 0.46
33 0.4
34 0.37
35 0.39
36 0.35
37 0.31
38 0.35
39 0.39
40 0.4
41 0.49
42 0.51
43 0.51
44 0.59
45 0.68
46 0.71
47 0.73
48 0.77
49 0.77
50 0.83
51 0.91