Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2SNP2

Protein Details
Accession A0A3M2SNP2    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
206-235AQETPKTSSAKRRERKKRAQEKQGSFDNGEHydrophilic
NLS Segment(s)
PositionSequence
215-224AKRRERKKRA
Subcellular Location(s) nucl 19.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MFSSAEPHLVPLPNPGLAKGSMWAQPGPPSQFFLTSPPLAGQPASLVQPPMSSYPREAQPAPPPSQLNLTSSPAAAEASTPISPNLPGYRRPPPPTSLSPYPQEQASVVPMTPSQRGPTSAPGPSQQQPPVPSQKLSSHETEKIQLLKRIADRRAWATQKRDESAERYRASLHDAVDAETDVAKLTNELQELAIQEQQIRNSTHLAQETPKTSSAKRRERKKRAQEKQGSFDNGEDGYDDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.22
4 0.21
5 0.22
6 0.17
7 0.18
8 0.18
9 0.2
10 0.2
11 0.19
12 0.24
13 0.29
14 0.32
15 0.3
16 0.3
17 0.29
18 0.31
19 0.3
20 0.29
21 0.29
22 0.24
23 0.24
24 0.21
25 0.21
26 0.19
27 0.18
28 0.14
29 0.1
30 0.11
31 0.12
32 0.12
33 0.12
34 0.11
35 0.12
36 0.14
37 0.16
38 0.17
39 0.16
40 0.19
41 0.23
42 0.26
43 0.29
44 0.29
45 0.3
46 0.36
47 0.42
48 0.43
49 0.42
50 0.4
51 0.37
52 0.41
53 0.37
54 0.32
55 0.28
56 0.27
57 0.24
58 0.22
59 0.21
60 0.16
61 0.15
62 0.11
63 0.08
64 0.06
65 0.08
66 0.08
67 0.09
68 0.08
69 0.09
70 0.09
71 0.11
72 0.15
73 0.15
74 0.18
75 0.23
76 0.31
77 0.36
78 0.41
79 0.42
80 0.41
81 0.45
82 0.46
83 0.49
84 0.46
85 0.44
86 0.42
87 0.41
88 0.38
89 0.32
90 0.27
91 0.19
92 0.15
93 0.13
94 0.11
95 0.09
96 0.08
97 0.09
98 0.1
99 0.11
100 0.11
101 0.11
102 0.11
103 0.13
104 0.14
105 0.18
106 0.19
107 0.19
108 0.2
109 0.2
110 0.23
111 0.23
112 0.25
113 0.23
114 0.23
115 0.24
116 0.27
117 0.33
118 0.31
119 0.29
120 0.28
121 0.31
122 0.33
123 0.33
124 0.33
125 0.29
126 0.31
127 0.31
128 0.3
129 0.28
130 0.29
131 0.28
132 0.28
133 0.25
134 0.26
135 0.31
136 0.35
137 0.35
138 0.33
139 0.33
140 0.35
141 0.42
142 0.44
143 0.44
144 0.43
145 0.48
146 0.49
147 0.48
148 0.47
149 0.41
150 0.41
151 0.43
152 0.45
153 0.39
154 0.35
155 0.34
156 0.32
157 0.34
158 0.31
159 0.24
160 0.2
161 0.2
162 0.2
163 0.19
164 0.19
165 0.14
166 0.11
167 0.11
168 0.07
169 0.06
170 0.05
171 0.05
172 0.07
173 0.09
174 0.09
175 0.1
176 0.1
177 0.12
178 0.13
179 0.14
180 0.14
181 0.12
182 0.14
183 0.16
184 0.17
185 0.2
186 0.21
187 0.2
188 0.22
189 0.23
190 0.25
191 0.26
192 0.26
193 0.25
194 0.29
195 0.3
196 0.3
197 0.33
198 0.32
199 0.34
200 0.42
201 0.48
202 0.54
203 0.61
204 0.69
205 0.76
206 0.84
207 0.91
208 0.92
209 0.93
210 0.93
211 0.95
212 0.95
213 0.92
214 0.89
215 0.87
216 0.8
217 0.7
218 0.61
219 0.52
220 0.41
221 0.33