Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2RUW3

Protein Details
Accession A0A3M2RUW3    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
44-69SVKTQGAYRKKSKRGIPKKLGAKRTGHydrophilic
202-237AKTTGLKTKRFRTRKQWFRHRRWRRERELEGQRKAABasic
247-268VKMVKMVSKKAAKKAKKASKKKBasic
NLS Segment(s)
PositionSequence
51-67YRKKSKRGIPKKLGAKR
208-268KTKRFRTRKQWFRHRRWRRERELEGQRKAAAKRAESGGDVKMVKMVSKKAAKKAKKASKKK
Subcellular Location(s) mito 23.5, cyto_mito 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001684  Ribosomal_L27  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01016  Ribosomal_L27  
Amino Acid Sequences MRFLTIQRPILAAVAGLARPAFTPITPLGAQLANALVEGRRNASVKTQGAYRKKSKRGIPKKLGAKRTGDQFVIPGNILYKQRGTHWWPGENCIMGRDHTIHAMATGYVKYYRDPARHPDRKYIGVVFNKSDTLPYPQHAERKRRLNMTMFPIKEAAAKPELSPSGIPFQVTRIEAGEPDRLLKLRKDYSYREDNWAIGQLAKTTGLKTKRFRTRKQWFRHRRWRRERELEGQRKAAAKRAESGGDVKMVKMVSKKAAKKAKKASKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.09
5 0.08
6 0.09
7 0.11
8 0.11
9 0.08
10 0.12
11 0.13
12 0.18
13 0.18
14 0.18
15 0.18
16 0.18
17 0.18
18 0.15
19 0.15
20 0.09
21 0.09
22 0.1
23 0.07
24 0.09
25 0.1
26 0.11
27 0.14
28 0.15
29 0.16
30 0.21
31 0.28
32 0.28
33 0.29
34 0.33
35 0.38
36 0.46
37 0.53
38 0.58
39 0.6
40 0.66
41 0.72
42 0.75
43 0.77
44 0.8
45 0.83
46 0.83
47 0.82
48 0.85
49 0.85
50 0.84
51 0.78
52 0.73
53 0.66
54 0.63
55 0.58
56 0.48
57 0.4
58 0.33
59 0.3
60 0.25
61 0.21
62 0.14
63 0.11
64 0.14
65 0.15
66 0.15
67 0.15
68 0.15
69 0.17
70 0.23
71 0.28
72 0.33
73 0.36
74 0.41
75 0.4
76 0.43
77 0.43
78 0.38
79 0.32
80 0.25
81 0.21
82 0.15
83 0.16
84 0.14
85 0.13
86 0.12
87 0.13
88 0.11
89 0.1
90 0.1
91 0.08
92 0.07
93 0.07
94 0.07
95 0.08
96 0.08
97 0.08
98 0.13
99 0.18
100 0.2
101 0.23
102 0.31
103 0.4
104 0.48
105 0.5
106 0.53
107 0.52
108 0.52
109 0.51
110 0.46
111 0.41
112 0.38
113 0.37
114 0.29
115 0.26
116 0.24
117 0.22
118 0.19
119 0.14
120 0.14
121 0.14
122 0.14
123 0.17
124 0.19
125 0.27
126 0.33
127 0.39
128 0.41
129 0.49
130 0.53
131 0.52
132 0.53
133 0.5
134 0.49
135 0.49
136 0.49
137 0.4
138 0.37
139 0.33
140 0.3
141 0.29
142 0.24
143 0.2
144 0.15
145 0.15
146 0.14
147 0.17
148 0.17
149 0.15
150 0.15
151 0.13
152 0.15
153 0.14
154 0.15
155 0.12
156 0.13
157 0.15
158 0.15
159 0.14
160 0.12
161 0.12
162 0.12
163 0.15
164 0.16
165 0.12
166 0.13
167 0.14
168 0.14
169 0.16
170 0.18
171 0.23
172 0.26
173 0.3
174 0.35
175 0.39
176 0.44
177 0.51
178 0.51
179 0.5
180 0.46
181 0.41
182 0.37
183 0.35
184 0.28
185 0.21
186 0.19
187 0.13
188 0.13
189 0.14
190 0.13
191 0.12
192 0.18
193 0.23
194 0.3
195 0.36
196 0.46
197 0.55
198 0.63
199 0.7
200 0.75
201 0.79
202 0.82
203 0.87
204 0.88
205 0.88
206 0.91
207 0.94
208 0.94
209 0.94
210 0.95
211 0.95
212 0.94
213 0.94
214 0.9
215 0.89
216 0.89
217 0.87
218 0.82
219 0.74
220 0.67
221 0.62
222 0.56
223 0.53
224 0.48
225 0.4
226 0.39
227 0.4
228 0.38
229 0.34
230 0.36
231 0.3
232 0.3
233 0.28
234 0.23
235 0.22
236 0.21
237 0.21
238 0.23
239 0.25
240 0.29
241 0.38
242 0.44
243 0.51
244 0.62
245 0.67
246 0.73
247 0.8
248 0.82