Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2S612

Protein Details
Accession A0A3M2S612    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
41-67GKLAAVRASKRNRYKNRRALREVQETHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 11, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MALSRRSSNPSVTDIRVVKDGASVTVDSSPKISFTRHPDDGKLAAVRASKRNRYKNRRALREVQETHYYNAPKCGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.35
3 0.33
4 0.3
5 0.24
6 0.21
7 0.2
8 0.13
9 0.13
10 0.12
11 0.1
12 0.14
13 0.14
14 0.12
15 0.13
16 0.12
17 0.12
18 0.13
19 0.14
20 0.15
21 0.22
22 0.28
23 0.32
24 0.33
25 0.32
26 0.34
27 0.33
28 0.3
29 0.24
30 0.17
31 0.15
32 0.16
33 0.18
34 0.24
35 0.29
36 0.37
37 0.45
38 0.56
39 0.65
40 0.72
41 0.8
42 0.83
43 0.87
44 0.88
45 0.86
46 0.85
47 0.83
48 0.84
49 0.76
50 0.71
51 0.69
52 0.62
53 0.57
54 0.54
55 0.48
56 0.39