Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2SDJ4

Protein Details
Accession A0A3M2SDJ4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
372-399ASLSGKIKAGRRTRRKQMERKLCMHHFEHydrophilic
NLS Segment(s)
PositionSequence
377-387KIKAGRRTRRK
Subcellular Location(s) cyto 18, cyto_nucl 10.5, cysk 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR003593  AAA+_ATPase  
IPR041569  AAA_lid_3  
IPR003959  ATPase_AAA_core  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
Pfam View protein in Pfam  
PF00004  AAA  
PF17862  AAA_lid_3  
Amino Acid Sequences MGNLDDIPLMPLSEVFYTLPKLKPTAKVIQFSSGDEIELCFETEVDGLFDDDTSSTEPCRIIWAPSGLLQGDSIEEVLHLVDEEAFDKEFEHGFDSVDSESDASEVSTKGVTAKIDKIREGCNEFEKQLLNAVVLPDDIDVSFDDVHVDPAAVTSLRALTALATAAPLAFTYGLLAKEKILGVLLHGPPGTGKTMLAKAVAKEAHVSFLPVSGADFLSKWVGEDEKLVRAIFSIARKLDPCVIFIDEADSVFRQRTEDDSSWKRDLVSQFLLEWDGVKGGAKGGFVMAATNRMSDIDPAVLRRLPRRIFVGVPTAAQREGILRIHLRDESLGPDVSVEELAKLTVSYSGSDLKSLCVSAAMAAVYESIYGNASLSGKIKAGRRTRRKQMERKLCMHHFEQAMSEIVATPQGGSAQAASPPKSVTRDLGIDAPSLAKLKKFGNMYAGSGNAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.12
4 0.16
5 0.21
6 0.24
7 0.25
8 0.29
9 0.33
10 0.4
11 0.45
12 0.51
13 0.53
14 0.56
15 0.55
16 0.59
17 0.55
18 0.49
19 0.47
20 0.37
21 0.31
22 0.25
23 0.23
24 0.17
25 0.16
26 0.15
27 0.1
28 0.09
29 0.09
30 0.1
31 0.09
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.08
40 0.09
41 0.1
42 0.1
43 0.12
44 0.13
45 0.12
46 0.18
47 0.18
48 0.18
49 0.22
50 0.25
51 0.24
52 0.26
53 0.28
54 0.23
55 0.22
56 0.19
57 0.15
58 0.12
59 0.11
60 0.08
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.04
67 0.04
68 0.04
69 0.05
70 0.06
71 0.07
72 0.08
73 0.08
74 0.08
75 0.09
76 0.1
77 0.1
78 0.12
79 0.11
80 0.11
81 0.12
82 0.13
83 0.11
84 0.11
85 0.1
86 0.08
87 0.07
88 0.07
89 0.07
90 0.05
91 0.06
92 0.06
93 0.07
94 0.07
95 0.07
96 0.08
97 0.1
98 0.11
99 0.13
100 0.2
101 0.26
102 0.29
103 0.31
104 0.33
105 0.35
106 0.39
107 0.4
108 0.35
109 0.34
110 0.34
111 0.32
112 0.32
113 0.28
114 0.23
115 0.23
116 0.2
117 0.15
118 0.14
119 0.13
120 0.11
121 0.1
122 0.1
123 0.06
124 0.06
125 0.06
126 0.05
127 0.05
128 0.07
129 0.07
130 0.06
131 0.08
132 0.08
133 0.09
134 0.08
135 0.08
136 0.06
137 0.06
138 0.07
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.05
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.03
157 0.03
158 0.04
159 0.06
160 0.07
161 0.08
162 0.09
163 0.08
164 0.1
165 0.1
166 0.09
167 0.08
168 0.07
169 0.07
170 0.13
171 0.13
172 0.13
173 0.13
174 0.13
175 0.12
176 0.13
177 0.13
178 0.07
179 0.07
180 0.08
181 0.1
182 0.11
183 0.12
184 0.12
185 0.11
186 0.15
187 0.16
188 0.14
189 0.14
190 0.14
191 0.14
192 0.13
193 0.13
194 0.09
195 0.09
196 0.09
197 0.06
198 0.06
199 0.06
200 0.06
201 0.05
202 0.05
203 0.05
204 0.06
205 0.06
206 0.06
207 0.06
208 0.06
209 0.06
210 0.09
211 0.09
212 0.1
213 0.12
214 0.11
215 0.1
216 0.1
217 0.11
218 0.11
219 0.11
220 0.13
221 0.13
222 0.14
223 0.15
224 0.16
225 0.2
226 0.18
227 0.18
228 0.16
229 0.16
230 0.15
231 0.14
232 0.15
233 0.09
234 0.09
235 0.09
236 0.07
237 0.07
238 0.07
239 0.07
240 0.06
241 0.07
242 0.1
243 0.16
244 0.18
245 0.24
246 0.29
247 0.34
248 0.35
249 0.35
250 0.32
251 0.3
252 0.29
253 0.27
254 0.25
255 0.2
256 0.19
257 0.19
258 0.19
259 0.15
260 0.14
261 0.09
262 0.06
263 0.05
264 0.06
265 0.05
266 0.06
267 0.07
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.07
274 0.06
275 0.08
276 0.08
277 0.08
278 0.08
279 0.09
280 0.09
281 0.09
282 0.1
283 0.09
284 0.1
285 0.11
286 0.13
287 0.14
288 0.15
289 0.19
290 0.26
291 0.25
292 0.27
293 0.31
294 0.31
295 0.31
296 0.32
297 0.34
298 0.27
299 0.27
300 0.26
301 0.23
302 0.2
303 0.18
304 0.16
305 0.11
306 0.13
307 0.13
308 0.14
309 0.15
310 0.16
311 0.18
312 0.18
313 0.17
314 0.16
315 0.15
316 0.15
317 0.16
318 0.15
319 0.12
320 0.12
321 0.12
322 0.11
323 0.11
324 0.08
325 0.06
326 0.06
327 0.06
328 0.06
329 0.06
330 0.05
331 0.07
332 0.08
333 0.08
334 0.1
335 0.15
336 0.15
337 0.17
338 0.17
339 0.15
340 0.16
341 0.15
342 0.13
343 0.09
344 0.09
345 0.08
346 0.09
347 0.07
348 0.06
349 0.06
350 0.06
351 0.06
352 0.06
353 0.06
354 0.05
355 0.06
356 0.06
357 0.06
358 0.07
359 0.08
360 0.09
361 0.11
362 0.12
363 0.13
364 0.17
365 0.23
366 0.3
367 0.39
368 0.49
369 0.58
370 0.67
371 0.76
372 0.84
373 0.89
374 0.91
375 0.92
376 0.92
377 0.9
378 0.88
379 0.87
380 0.81
381 0.76
382 0.67
383 0.63
384 0.53
385 0.46
386 0.4
387 0.32
388 0.28
389 0.22
390 0.2
391 0.14
392 0.12
393 0.12
394 0.1
395 0.08
396 0.07
397 0.08
398 0.08
399 0.08
400 0.09
401 0.09
402 0.14
403 0.18
404 0.2
405 0.21
406 0.22
407 0.26
408 0.28
409 0.29
410 0.28
411 0.29
412 0.3
413 0.3
414 0.33
415 0.31
416 0.27
417 0.26
418 0.23
419 0.2
420 0.2
421 0.19
422 0.16
423 0.19
424 0.2
425 0.26
426 0.29
427 0.3
428 0.35
429 0.36
430 0.38
431 0.37