Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M2SAD5

Protein Details
Accession A0A3M2SAD5    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
162-197ASDIFAREKRRRRQEKRDRERVKKGKKPKHRFVGEDBasic
356-382LERERAREERRARRAERGYRRSRQEEVBasic
NLS Segment(s)
PositionSequence
168-192REKRRRRQEKRDRERVKKGKKPKHR
359-376ERAREERRARRAERGYRR
Subcellular Location(s) nucl 9, cyto_nucl 9, cyto 7, mito 6, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPAPIRIRAAEAISTVSGHLFEATKVLLARDDDDDKNDRHKPTVDPESGSFDPHDISNAGFFFLFALIGVAFVAGGIWFFFWAKNGGFQFKETDWDDYKSTVLRRTGPNGTILSNATRPTNLGGGSVYKDVADDETHYDAHDDGQTVITEATGLSGITAGASDIFAREKRRRRQEKRDRERVKKGKKPKHRFVGEDGVEDEDAERSAKKELRNYRHEKAARVGGINKESEGSQWDGSTNPTESNVSTTLLSDRQTTPTTTPTKPSGGIRKVYSVADRRADREQERMRAEARRLREAGRAARRDYSYQRAESYSRAESQASESLLDGSQVTRTTGDSGSDLGTKSYHHPMPELRELERERAREERRARRAERGYRRSRQEEVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.16
4 0.13
5 0.11
6 0.1
7 0.11
8 0.09
9 0.09
10 0.1
11 0.1
12 0.12
13 0.12
14 0.12
15 0.14
16 0.14
17 0.16
18 0.19
19 0.24
20 0.23
21 0.27
22 0.32
23 0.31
24 0.38
25 0.42
26 0.4
27 0.39
28 0.41
29 0.42
30 0.46
31 0.53
32 0.49
33 0.46
34 0.46
35 0.5
36 0.46
37 0.43
38 0.34
39 0.25
40 0.23
41 0.19
42 0.19
43 0.12
44 0.12
45 0.13
46 0.12
47 0.12
48 0.11
49 0.11
50 0.09
51 0.09
52 0.08
53 0.05
54 0.06
55 0.05
56 0.05
57 0.05
58 0.04
59 0.03
60 0.03
61 0.03
62 0.02
63 0.03
64 0.03
65 0.03
66 0.04
67 0.04
68 0.05
69 0.06
70 0.09
71 0.09
72 0.15
73 0.17
74 0.21
75 0.22
76 0.23
77 0.26
78 0.23
79 0.28
80 0.24
81 0.27
82 0.26
83 0.28
84 0.28
85 0.25
86 0.25
87 0.24
88 0.24
89 0.24
90 0.25
91 0.27
92 0.3
93 0.35
94 0.38
95 0.36
96 0.38
97 0.33
98 0.31
99 0.28
100 0.25
101 0.22
102 0.19
103 0.19
104 0.16
105 0.15
106 0.14
107 0.14
108 0.15
109 0.12
110 0.11
111 0.1
112 0.11
113 0.13
114 0.13
115 0.11
116 0.09
117 0.09
118 0.09
119 0.09
120 0.08
121 0.08
122 0.1
123 0.11
124 0.12
125 0.11
126 0.12
127 0.11
128 0.11
129 0.11
130 0.09
131 0.08
132 0.09
133 0.08
134 0.09
135 0.08
136 0.07
137 0.06
138 0.05
139 0.05
140 0.04
141 0.04
142 0.03
143 0.03
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.03
150 0.03
151 0.03
152 0.05
153 0.07
154 0.13
155 0.21
156 0.3
157 0.39
158 0.5
159 0.61
160 0.7
161 0.79
162 0.85
163 0.89
164 0.91
165 0.93
166 0.91
167 0.89
168 0.9
169 0.89
170 0.88
171 0.85
172 0.85
173 0.84
174 0.86
175 0.87
176 0.86
177 0.86
178 0.8
179 0.75
180 0.7
181 0.7
182 0.59
183 0.5
184 0.41
185 0.32
186 0.26
187 0.23
188 0.17
189 0.07
190 0.06
191 0.06
192 0.05
193 0.05
194 0.09
195 0.12
196 0.15
197 0.22
198 0.32
199 0.4
200 0.5
201 0.56
202 0.56
203 0.62
204 0.62
205 0.56
206 0.51
207 0.48
208 0.39
209 0.34
210 0.34
211 0.28
212 0.28
213 0.25
214 0.22
215 0.17
216 0.15
217 0.14
218 0.13
219 0.12
220 0.1
221 0.1
222 0.11
223 0.11
224 0.12
225 0.14
226 0.12
227 0.1
228 0.11
229 0.11
230 0.11
231 0.13
232 0.13
233 0.12
234 0.11
235 0.12
236 0.12
237 0.13
238 0.14
239 0.14
240 0.15
241 0.17
242 0.18
243 0.2
244 0.19
245 0.25
246 0.3
247 0.28
248 0.31
249 0.31
250 0.31
251 0.32
252 0.36
253 0.39
254 0.38
255 0.42
256 0.39
257 0.39
258 0.39
259 0.38
260 0.39
261 0.35
262 0.35
263 0.37
264 0.37
265 0.37
266 0.41
267 0.46
268 0.41
269 0.45
270 0.46
271 0.47
272 0.48
273 0.47
274 0.45
275 0.45
276 0.49
277 0.45
278 0.43
279 0.43
280 0.42
281 0.42
282 0.44
283 0.45
284 0.48
285 0.52
286 0.52
287 0.47
288 0.51
289 0.51
290 0.51
291 0.51
292 0.5
293 0.46
294 0.44
295 0.44
296 0.41
297 0.41
298 0.38
299 0.38
300 0.32
301 0.29
302 0.28
303 0.26
304 0.24
305 0.26
306 0.27
307 0.23
308 0.2
309 0.18
310 0.18
311 0.17
312 0.17
313 0.13
314 0.09
315 0.11
316 0.11
317 0.11
318 0.1
319 0.11
320 0.14
321 0.14
322 0.15
323 0.14
324 0.14
325 0.15
326 0.16
327 0.16
328 0.14
329 0.13
330 0.14
331 0.17
332 0.24
333 0.25
334 0.24
335 0.28
336 0.33
337 0.41
338 0.48
339 0.46
340 0.4
341 0.46
342 0.48
343 0.53
344 0.53
345 0.48
346 0.43
347 0.5
348 0.53
349 0.54
350 0.62
351 0.64
352 0.68
353 0.75
354 0.75
355 0.76
356 0.81
357 0.83
358 0.84
359 0.84
360 0.84
361 0.83
362 0.89
363 0.84