Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M2S066

Protein Details
Accession A0A3M2S066    Localization Confidence High Confidence Score 23.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-23QDPNLYGQRAPKKQKRDATLSHydrophilic
43-62TSSGRSRPSKERKEDIFKGSHydrophilic
278-297TEEQRRTREDQKEARRREIEBasic
NLS Segment(s)
PositionSequence
47-69RSRPSKERKEDIFKGSKPKRSKD
281-310QRRTREDQKEARRREIEKRREDMAARRAKK
Subcellular Location(s) nucl 21, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR025066  CCDC174-like  
Pfam View protein in Pfam  
PF13300  DUF4078  
Amino Acid Sequences MPQDPNLYGQRAPKKQKRDATLSTSLDFTAQLTSLMSNASGPTSSGRSRPSKERKEDIFKGSKPKRSKDSDESKKLQLKEVAGTEEETKELARARRRMEEKARLYAAMKRGDYVPKENEAAPLVDFDRKWAQGEEERKEDYETSSDDDADDSGEMVEYEDEFGRVRQVTKAERDRLERRARRGLLGAEELERMSARPSAPGNLIYGDAVQSMAFNPEDPEKMEELARKRDRSATPPPDQHYDADWEIRTKGTGFYKFSKDEETRTVEMEGLAEERRKTEEQRRTREDQKEARRREIEKRREDMAARRAKKQADSFLDRLGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.76
3 0.82
4 0.81
5 0.8
6 0.78
7 0.76
8 0.76
9 0.7
10 0.61
11 0.53
12 0.45
13 0.36
14 0.29
15 0.21
16 0.13
17 0.1
18 0.09
19 0.09
20 0.09
21 0.08
22 0.09
23 0.08
24 0.07
25 0.07
26 0.08
27 0.07
28 0.08
29 0.1
30 0.14
31 0.16
32 0.2
33 0.26
34 0.32
35 0.38
36 0.48
37 0.56
38 0.62
39 0.69
40 0.74
41 0.76
42 0.79
43 0.8
44 0.78
45 0.76
46 0.7
47 0.73
48 0.71
49 0.71
50 0.69
51 0.7
52 0.69
53 0.69
54 0.73
55 0.72
56 0.76
57 0.78
58 0.8
59 0.77
60 0.76
61 0.74
62 0.67
63 0.62
64 0.55
65 0.47
66 0.41
67 0.39
68 0.33
69 0.27
70 0.27
71 0.23
72 0.2
73 0.18
74 0.14
75 0.11
76 0.11
77 0.14
78 0.19
79 0.24
80 0.29
81 0.33
82 0.42
83 0.45
84 0.53
85 0.57
86 0.62
87 0.59
88 0.6
89 0.57
90 0.49
91 0.47
92 0.43
93 0.4
94 0.35
95 0.31
96 0.26
97 0.27
98 0.31
99 0.32
100 0.32
101 0.29
102 0.26
103 0.28
104 0.27
105 0.26
106 0.22
107 0.2
108 0.15
109 0.13
110 0.12
111 0.13
112 0.12
113 0.13
114 0.16
115 0.15
116 0.16
117 0.16
118 0.17
119 0.21
120 0.28
121 0.29
122 0.29
123 0.29
124 0.28
125 0.29
126 0.27
127 0.21
128 0.17
129 0.14
130 0.14
131 0.13
132 0.13
133 0.12
134 0.11
135 0.1
136 0.08
137 0.07
138 0.04
139 0.04
140 0.04
141 0.04
142 0.04
143 0.04
144 0.03
145 0.04
146 0.04
147 0.04
148 0.05
149 0.05
150 0.06
151 0.07
152 0.08
153 0.09
154 0.13
155 0.16
156 0.23
157 0.3
158 0.34
159 0.37
160 0.42
161 0.45
162 0.5
163 0.57
164 0.55
165 0.54
166 0.57
167 0.55
168 0.5
169 0.48
170 0.41
171 0.33
172 0.3
173 0.25
174 0.17
175 0.16
176 0.14
177 0.12
178 0.1
179 0.08
180 0.07
181 0.09
182 0.08
183 0.1
184 0.11
185 0.13
186 0.14
187 0.15
188 0.15
189 0.13
190 0.13
191 0.11
192 0.1
193 0.08
194 0.07
195 0.06
196 0.05
197 0.05
198 0.05
199 0.06
200 0.06
201 0.06
202 0.07
203 0.09
204 0.1
205 0.12
206 0.14
207 0.13
208 0.14
209 0.17
210 0.2
211 0.23
212 0.32
213 0.37
214 0.36
215 0.37
216 0.44
217 0.45
218 0.47
219 0.54
220 0.52
221 0.54
222 0.59
223 0.61
224 0.58
225 0.57
226 0.51
227 0.42
228 0.39
229 0.32
230 0.29
231 0.26
232 0.22
233 0.21
234 0.2
235 0.19
236 0.14
237 0.18
238 0.21
239 0.26
240 0.29
241 0.33
242 0.39
243 0.41
244 0.41
245 0.44
246 0.4
247 0.39
248 0.4
249 0.41
250 0.37
251 0.36
252 0.35
253 0.28
254 0.25
255 0.22
256 0.16
257 0.12
258 0.13
259 0.14
260 0.14
261 0.14
262 0.19
263 0.22
264 0.28
265 0.36
266 0.44
267 0.52
268 0.62
269 0.68
270 0.71
271 0.77
272 0.79
273 0.78
274 0.78
275 0.79
276 0.8
277 0.79
278 0.81
279 0.79
280 0.75
281 0.77
282 0.77
283 0.77
284 0.76
285 0.74
286 0.68
287 0.67
288 0.66
289 0.64
290 0.64
291 0.64
292 0.58
293 0.6
294 0.62
295 0.61
296 0.64
297 0.62
298 0.62
299 0.61
300 0.65
301 0.61