Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2L520

Protein Details
Accession E2L520    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MTRRDTRTLKKSIRSPKDTKHTREBasic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 9, E.R. 2, pero 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR004648  Oligpept_transpt  
IPR004813  OPT  
Gene Ontology GO:0016020  C:membrane  
GO:0035673  F:oligopeptide transmembrane transporter activity  
GO:0015031  P:protein transport  
KEGG mpr:MPER_00835  -  
Pfam View protein in Pfam  
PF03169  OPT  
Amino Acid Sequences MTRRDTRTLKKSIRSPKDTKHTRENPSSQAVADVSKFIVDLRDDGDDAVTIRSLVLGTLIAGLGAALVQIYYFKPVVVSVSTVFLLLVAWTIGEAMANLLPRRSTVQGTRFEFLGPVVHAINPGPFGLKEFKG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.78
4 0.81
5 0.82
6 0.8
7 0.8
8 0.78
9 0.78
10 0.79
11 0.75
12 0.69
13 0.64
14 0.59
15 0.48
16 0.4
17 0.33
18 0.25
19 0.2
20 0.15
21 0.1
22 0.09
23 0.09
24 0.07
25 0.09
26 0.08
27 0.08
28 0.09
29 0.1
30 0.1
31 0.1
32 0.1
33 0.08
34 0.08
35 0.08
36 0.06
37 0.05
38 0.04
39 0.05
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.02
51 0.02
52 0.02
53 0.01
54 0.01
55 0.01
56 0.02
57 0.03
58 0.04
59 0.05
60 0.05
61 0.05
62 0.05
63 0.07
64 0.07
65 0.08
66 0.07
67 0.08
68 0.09
69 0.09
70 0.08
71 0.07
72 0.06
73 0.05
74 0.05
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.03
83 0.05
84 0.07
85 0.07
86 0.08
87 0.08
88 0.1
89 0.13
90 0.15
91 0.18
92 0.23
93 0.3
94 0.38
95 0.42
96 0.43
97 0.4
98 0.38
99 0.34
100 0.27
101 0.24
102 0.15
103 0.13
104 0.13
105 0.12
106 0.13
107 0.13
108 0.14
109 0.12
110 0.11
111 0.12
112 0.11
113 0.14