Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VPU5

Protein Details
Accession K1VPU5   
Localization Confidence Low
Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
21-41YRLSSTRKANLRKRLRRVDDVHydrophilic
77-97DPKYRGWRKGIHKVPKWTRITBasic
NLS Segment(s)
Subcellular Location(s) mito 21.5, mito_nucl 11.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPTSFVNGSLLWKVPYRLSSTRKANLRKRLRRVDDVIAAVAESGVQTRSLERAQALPTEAEMKPKDKYTVFDPKYRGWRKGIHKVPKWTRITIRENPKGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.19
4 0.19
5 0.2
6 0.19
7 0.2
8 0.25
9 0.3
10 0.34
11 0.41
12 0.47
13 0.53
14 0.58
15 0.65
16 0.67
17 0.7
18 0.77
19 0.78
20 0.8
21 0.83
22 0.82
23 0.79
24 0.75
25 0.7
26 0.62
27 0.53
28 0.44
29 0.33
30 0.26
31 0.19
32 0.14
33 0.08
34 0.04
35 0.03
36 0.03
37 0.03
38 0.04
39 0.04
40 0.07
41 0.07
42 0.08
43 0.08
44 0.1
45 0.11
46 0.11
47 0.12
48 0.1
49 0.1
50 0.14
51 0.13
52 0.16
53 0.17
54 0.18
55 0.19
56 0.21
57 0.24
58 0.21
59 0.24
60 0.25
61 0.35
62 0.36
63 0.4
64 0.42
65 0.45
66 0.55
67 0.58
68 0.55
69 0.49
70 0.55
71 0.57
72 0.65
73 0.68
74 0.68
75 0.71
76 0.78
77 0.82
78 0.83
79 0.8
80 0.76
81 0.74
82 0.73
83 0.73
84 0.71
85 0.73