Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M7AU50

Protein Details
Accession A0A3M7AU50    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
184-203SSTPRLSKGPKRYQRNTSADHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 13.5, cyto_nucl 10.5, nucl 6.5, pero 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR000277  Cys/Met-Metab_PyrdxlP-dep_enz  
IPR015424  PyrdxlP-dep_Trfase  
IPR015421  PyrdxlP-dep_Trfase_major  
IPR015422  PyrdxlP-dep_Trfase_small  
Gene Ontology GO:0003824  F:catalytic activity  
GO:0030170  F:pyridoxal phosphate binding  
GO:0019346  P:transsulfuration  
Pfam View protein in Pfam  
PF01053  Cys_Met_Meta_PP  
Amino Acid Sequences MPGLPTVLPWNQTLGETIPPDTPHAVSVSLPTWKSNVGYEEGEQWVVDKMQTGYPRFFIHKSIQRLAQAILTQHGNTETENAMLVASKSCGTRCRNFLIKQNSLVDQSVIRILEFVPHPDRTTSADMTRVRPRLTAVIYPKEFWPTAKVFWQHTGEGISSRQAEFCHRAYDDGIMAEHSAVAHSSTPRLSKGPKRYQRNTSADQTHGNGANGHTNGDAAAGETGVPDSAQFVEERFGRNLSIAFAAQAKLAIRKRIAGSLTKDMDLPQSLDEPHDSGNERGRDVPGFSVEDVYLYGMGMNAIFNAHRCLMLSRGEMPSVMYGFPYVDTLKVLEKFGPGATFYGFGTQEELDDLERRCENGEKYLSLFCEFPGNPLLKSPDLKRIRAIADKYDIAVVVDETIGNFLNIHVLPYADVVVSSLTKVFSGDSNVMGGTMILNPQSRYYAGLKKTLETEYEDNQFEEDSMYLERNSRDFVDRIQRINHNAGVIADVLRAHPCVKQVNYPKYSETKHHYDTCKLPDGGYGGLLSATFHSMEDAQIFYDHLDTHKGPSLGTNFTLSSPFVILAHYNELDWAAQFGCEASLIRFSVGLEDTDALKKVFEFALAAILEKNSQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.21
4 0.22
5 0.22
6 0.22
7 0.25
8 0.25
9 0.24
10 0.2
11 0.2
12 0.19
13 0.16
14 0.18
15 0.19
16 0.22
17 0.22
18 0.22
19 0.22
20 0.23
21 0.24
22 0.24
23 0.24
24 0.22
25 0.24
26 0.24
27 0.27
28 0.27
29 0.26
30 0.21
31 0.19
32 0.17
33 0.15
34 0.14
35 0.13
36 0.13
37 0.18
38 0.24
39 0.27
40 0.28
41 0.3
42 0.34
43 0.35
44 0.35
45 0.34
46 0.38
47 0.43
48 0.48
49 0.51
50 0.52
51 0.51
52 0.51
53 0.47
54 0.41
55 0.35
56 0.29
57 0.26
58 0.23
59 0.2
60 0.19
61 0.2
62 0.16
63 0.14
64 0.16
65 0.14
66 0.12
67 0.12
68 0.11
69 0.1
70 0.1
71 0.1
72 0.08
73 0.09
74 0.1
75 0.11
76 0.13
77 0.2
78 0.26
79 0.32
80 0.36
81 0.43
82 0.49
83 0.52
84 0.6
85 0.62
86 0.61
87 0.59
88 0.58
89 0.53
90 0.47
91 0.44
92 0.35
93 0.26
94 0.22
95 0.2
96 0.17
97 0.14
98 0.12
99 0.11
100 0.15
101 0.15
102 0.19
103 0.2
104 0.22
105 0.23
106 0.24
107 0.25
108 0.25
109 0.29
110 0.27
111 0.25
112 0.31
113 0.32
114 0.37
115 0.43
116 0.43
117 0.38
118 0.36
119 0.37
120 0.35
121 0.35
122 0.37
123 0.36
124 0.41
125 0.41
126 0.42
127 0.41
128 0.39
129 0.36
130 0.3
131 0.29
132 0.23
133 0.24
134 0.29
135 0.32
136 0.3
137 0.36
138 0.38
139 0.33
140 0.31
141 0.3
142 0.24
143 0.22
144 0.2
145 0.17
146 0.15
147 0.16
148 0.15
149 0.14
150 0.19
151 0.21
152 0.22
153 0.24
154 0.22
155 0.23
156 0.23
157 0.24
158 0.19
159 0.16
160 0.14
161 0.1
162 0.1
163 0.09
164 0.08
165 0.06
166 0.05
167 0.05
168 0.05
169 0.07
170 0.07
171 0.09
172 0.11
173 0.12
174 0.14
175 0.17
176 0.23
177 0.3
178 0.4
179 0.5
180 0.57
181 0.66
182 0.72
183 0.77
184 0.81
185 0.8
186 0.75
187 0.72
188 0.67
189 0.59
190 0.54
191 0.46
192 0.4
193 0.34
194 0.28
195 0.22
196 0.18
197 0.2
198 0.18
199 0.17
200 0.13
201 0.12
202 0.11
203 0.1
204 0.09
205 0.05
206 0.05
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.03
213 0.03
214 0.04
215 0.04
216 0.05
217 0.05
218 0.05
219 0.08
220 0.09
221 0.12
222 0.13
223 0.13
224 0.12
225 0.13
226 0.13
227 0.11
228 0.11
229 0.09
230 0.08
231 0.09
232 0.09
233 0.08
234 0.09
235 0.08
236 0.13
237 0.16
238 0.18
239 0.18
240 0.21
241 0.22
242 0.25
243 0.26
244 0.25
245 0.27
246 0.31
247 0.32
248 0.29
249 0.28
250 0.25
251 0.24
252 0.2
253 0.16
254 0.1
255 0.1
256 0.1
257 0.1
258 0.1
259 0.09
260 0.09
261 0.11
262 0.11
263 0.11
264 0.17
265 0.17
266 0.18
267 0.18
268 0.18
269 0.17
270 0.16
271 0.15
272 0.11
273 0.11
274 0.1
275 0.1
276 0.09
277 0.09
278 0.08
279 0.07
280 0.05
281 0.04
282 0.04
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.03
290 0.04
291 0.05
292 0.06
293 0.06
294 0.06
295 0.07
296 0.09
297 0.11
298 0.12
299 0.13
300 0.13
301 0.13
302 0.13
303 0.12
304 0.11
305 0.1
306 0.08
307 0.06
308 0.05
309 0.05
310 0.05
311 0.06
312 0.06
313 0.05
314 0.06
315 0.07
316 0.09
317 0.1
318 0.1
319 0.1
320 0.1
321 0.1
322 0.11
323 0.1
324 0.08
325 0.08
326 0.08
327 0.08
328 0.07
329 0.09
330 0.09
331 0.08
332 0.1
333 0.09
334 0.09
335 0.08
336 0.09
337 0.07
338 0.1
339 0.1
340 0.11
341 0.11
342 0.12
343 0.13
344 0.16
345 0.16
346 0.19
347 0.2
348 0.19
349 0.2
350 0.22
351 0.22
352 0.19
353 0.18
354 0.13
355 0.17
356 0.16
357 0.16
358 0.18
359 0.18
360 0.17
361 0.18
362 0.21
363 0.17
364 0.2
365 0.21
366 0.27
367 0.3
368 0.31
369 0.32
370 0.33
371 0.35
372 0.39
373 0.38
374 0.32
375 0.32
376 0.31
377 0.29
378 0.25
379 0.21
380 0.15
381 0.13
382 0.09
383 0.05
384 0.05
385 0.05
386 0.04
387 0.05
388 0.05
389 0.04
390 0.05
391 0.04
392 0.07
393 0.07
394 0.08
395 0.07
396 0.07
397 0.08
398 0.08
399 0.09
400 0.05
401 0.05
402 0.05
403 0.05
404 0.05
405 0.05
406 0.06
407 0.06
408 0.06
409 0.06
410 0.07
411 0.07
412 0.1
413 0.11
414 0.1
415 0.11
416 0.11
417 0.1
418 0.1
419 0.09
420 0.06
421 0.05
422 0.06
423 0.07
424 0.08
425 0.09
426 0.1
427 0.11
428 0.11
429 0.14
430 0.18
431 0.24
432 0.25
433 0.31
434 0.31
435 0.31
436 0.34
437 0.32
438 0.29
439 0.27
440 0.28
441 0.25
442 0.29
443 0.29
444 0.25
445 0.24
446 0.23
447 0.18
448 0.15
449 0.11
450 0.08
451 0.08
452 0.09
453 0.09
454 0.12
455 0.13
456 0.13
457 0.15
458 0.16
459 0.19
460 0.19
461 0.24
462 0.31
463 0.34
464 0.37
465 0.4
466 0.43
467 0.44
468 0.47
469 0.43
470 0.33
471 0.29
472 0.26
473 0.22
474 0.18
475 0.14
476 0.1
477 0.08
478 0.09
479 0.09
480 0.1
481 0.1
482 0.11
483 0.14
484 0.2
485 0.22
486 0.31
487 0.4
488 0.49
489 0.52
490 0.52
491 0.53
492 0.53
493 0.54
494 0.52
495 0.5
496 0.48
497 0.51
498 0.56
499 0.56
500 0.56
501 0.6
502 0.59
503 0.6
504 0.52
505 0.46
506 0.4
507 0.38
508 0.32
509 0.26
510 0.19
511 0.11
512 0.11
513 0.1
514 0.08
515 0.07
516 0.08
517 0.07
518 0.07
519 0.08
520 0.09
521 0.1
522 0.1
523 0.1
524 0.1
525 0.1
526 0.1
527 0.09
528 0.1
529 0.1
530 0.1
531 0.15
532 0.15
533 0.18
534 0.24
535 0.23
536 0.22
537 0.27
538 0.3
539 0.28
540 0.28
541 0.27
542 0.22
543 0.23
544 0.25
545 0.19
546 0.17
547 0.15
548 0.14
549 0.11
550 0.12
551 0.12
552 0.13
553 0.18
554 0.17
555 0.16
556 0.15
557 0.16
558 0.15
559 0.14
560 0.13
561 0.08
562 0.08
563 0.08
564 0.08
565 0.07
566 0.08
567 0.08
568 0.08
569 0.12
570 0.13
571 0.13
572 0.13
573 0.13
574 0.16
575 0.16
576 0.15
577 0.13
578 0.14
579 0.16
580 0.18
581 0.2
582 0.16
583 0.15
584 0.15
585 0.16
586 0.15
587 0.13
588 0.12
589 0.11
590 0.16
591 0.16
592 0.17
593 0.15
594 0.15