Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M6ZS37

Protein Details
Accession A0A3M6ZS37    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-29SSQHNQAKKNHKNGIKKPQTHydrophilic
NLS Segment(s)
PositionSequence
17-64KKNHKNGIKKPQTHRYPSLKGTDPKFRRNHRHALHGTMRALKEAKEGK
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAIFAESKNSSQHNQAKKNHKNGIKKPQTHRYPSLKGTDPKFRRNHRHALHGTMRALKEAKEGKRDAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.59
3 0.67
4 0.72
5 0.79
6 0.79
7 0.78
8 0.78
9 0.79
10 0.81
11 0.8
12 0.79
13 0.78
14 0.8
15 0.79
16 0.75
17 0.74
18 0.7
19 0.65
20 0.6
21 0.58
22 0.53
23 0.51
24 0.48
25 0.51
26 0.48
27 0.52
28 0.57
29 0.6
30 0.65
31 0.66
32 0.73
33 0.66
34 0.72
35 0.66
36 0.66
37 0.64
38 0.59
39 0.55
40 0.51
41 0.47
42 0.4
43 0.38
44 0.3
45 0.32
46 0.35
47 0.38
48 0.4