Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6Y1L8

Protein Details
Accession A0A3M6Y1L8    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
24-50VPKTRRTYCKGKDCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 12, cyto 4.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MGASSGSWSGSKDNVADLFSQVNVPKTRRTYCKGKDCKKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTSCKTKAQLSLKRCKHFELGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.16
4 0.16
5 0.15
6 0.14
7 0.16
8 0.14
9 0.18
10 0.21
11 0.23
12 0.28
13 0.33
14 0.39
15 0.44
16 0.49
17 0.54
18 0.59
19 0.68
20 0.72
21 0.76
22 0.79
23 0.8
24 0.85
25 0.84
26 0.85
27 0.84
28 0.84
29 0.82
30 0.83
31 0.85
32 0.77
33 0.76
34 0.69
35 0.63
36 0.55
37 0.49
38 0.38
39 0.3
40 0.29
41 0.28
42 0.27
43 0.24
44 0.29
45 0.33
46 0.37
47 0.41
48 0.45
49 0.42
50 0.49
51 0.57
52 0.55
53 0.57
54 0.57
55 0.57
56 0.57
57 0.6
58 0.51
59 0.47
60 0.44
61 0.37
62 0.4
63 0.42
64 0.4
65 0.36
66 0.43
67 0.47
68 0.55
69 0.64
70 0.67
71 0.66
72 0.7
73 0.76
74 0.77
75 0.75
76 0.73
77 0.69
78 0.66
79 0.65
80 0.61
81 0.56
82 0.52
83 0.46
84 0.41
85 0.38
86 0.38
87 0.41
88 0.47
89 0.51
90 0.55
91 0.64
92 0.7
93 0.76
94 0.73
95 0.68