Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VKS6

Protein Details
Accession K1VKS6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
92-116NARVATQKSERRRRRLNPQSNGGRAHydrophilic
NLS Segment(s)
PositionSequence
19-21PPK
99-123KSERRRRRLNPQSNGGRAAPGPRNR
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 6.5, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPLPPNEEDEKLILAGKRPPKLARKEAARLEHWNEENEAWQYTPGRFWPPGYGPYGREESEPAEGGGDGSEASRHDSNLAEGGAKKTEHAANARVATQKSERRRRRLNPQSNGGRAAPGPRNRNGRPDTEGVTARSGPVPIRLSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.25
3 0.3
4 0.32
5 0.36
6 0.42
7 0.48
8 0.56
9 0.61
10 0.63
11 0.64
12 0.68
13 0.71
14 0.7
15 0.66
16 0.62
17 0.59
18 0.57
19 0.51
20 0.44
21 0.38
22 0.32
23 0.3
24 0.26
25 0.22
26 0.14
27 0.14
28 0.14
29 0.13
30 0.14
31 0.14
32 0.17
33 0.16
34 0.17
35 0.2
36 0.21
37 0.24
38 0.26
39 0.26
40 0.23
41 0.25
42 0.27
43 0.23
44 0.21
45 0.19
46 0.17
47 0.17
48 0.16
49 0.13
50 0.1
51 0.09
52 0.09
53 0.07
54 0.06
55 0.04
56 0.03
57 0.04
58 0.04
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.08
65 0.09
66 0.09
67 0.07
68 0.08
69 0.09
70 0.1
71 0.1
72 0.1
73 0.11
74 0.12
75 0.14
76 0.16
77 0.17
78 0.19
79 0.2
80 0.22
81 0.23
82 0.22
83 0.22
84 0.27
85 0.32
86 0.39
87 0.49
88 0.55
89 0.61
90 0.71
91 0.76
92 0.81
93 0.84
94 0.85
95 0.83
96 0.84
97 0.83
98 0.76
99 0.72
100 0.61
101 0.52
102 0.42
103 0.4
104 0.38
105 0.37
106 0.39
107 0.42
108 0.5
109 0.51
110 0.6
111 0.57
112 0.54
113 0.52
114 0.51
115 0.48
116 0.45
117 0.46
118 0.38
119 0.39
120 0.34
121 0.3
122 0.27
123 0.24
124 0.19
125 0.23