Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M7AEH1

Protein Details
Accession A0A3M7AEH1    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-119ARLRTRTGRRVLLRRKLKGRNTLSHHydrophilic
NLS Segment(s)
PositionSequence
76-114KRTTFKPSHRVRKRIHGFLARLRTRTGRRVLLRRKLKGR
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFCSRCIRSAFAPSKSVTSVLKQASRVTSQRFAQPQQQRPTLPARIPAPVKEDTPTSSLRPLSQPSLPTLQVRGAKRTTFKPSHRVRKRIHGFLARLRTRTGRRVLLRRKLKGRNTLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.39
3 0.38
4 0.29
5 0.25
6 0.28
7 0.29
8 0.31
9 0.3
10 0.32
11 0.33
12 0.37
13 0.38
14 0.37
15 0.38
16 0.36
17 0.42
18 0.43
19 0.42
20 0.46
21 0.51
22 0.55
23 0.56
24 0.59
25 0.52
26 0.5
27 0.54
28 0.5
29 0.42
30 0.38
31 0.32
32 0.33
33 0.33
34 0.32
35 0.29
36 0.26
37 0.25
38 0.21
39 0.21
40 0.18
41 0.19
42 0.19
43 0.16
44 0.17
45 0.17
46 0.17
47 0.18
48 0.18
49 0.18
50 0.18
51 0.18
52 0.18
53 0.2
54 0.2
55 0.19
56 0.18
57 0.2
58 0.24
59 0.24
60 0.26
61 0.26
62 0.27
63 0.3
64 0.34
65 0.38
66 0.4
67 0.43
68 0.49
69 0.57
70 0.65
71 0.72
72 0.76
73 0.72
74 0.75
75 0.79
76 0.77
77 0.74
78 0.71
79 0.66
80 0.65
81 0.71
82 0.64
83 0.57
84 0.52
85 0.52
86 0.49
87 0.52
88 0.51
89 0.5
90 0.55
91 0.64
92 0.71
93 0.74
94 0.79
95 0.81
96 0.84
97 0.84
98 0.84
99 0.84