Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1VEM8

Protein Details
Accession K1VEM8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-46MPSHIPIVKKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
9-52KKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQLPMPK
Subcellular Location(s) nucl 15, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPSHIPIVKKRTKHFKRHQSDRYHGVKESWRKPKGIDNRVRRRFKGQLPMPKIGYGSNKKTRHLIPSGHKEVLVHNLADLELLLMHSNQYAAAIAHGVSSKKRIEILSRAKILGVKVTNAAAKLRTEEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.87
4 0.91
5 0.91
6 0.89
7 0.87
8 0.85
9 0.81
10 0.74
11 0.64
12 0.57
13 0.56
14 0.56
15 0.58
16 0.59
17 0.55
18 0.52
19 0.53
20 0.58
21 0.61
22 0.62
23 0.62
24 0.63
25 0.71
26 0.8
27 0.84
28 0.77
29 0.74
30 0.71
31 0.68
32 0.67
33 0.64
34 0.64
35 0.64
36 0.65
37 0.59
38 0.52
39 0.46
40 0.37
41 0.37
42 0.33
43 0.35
44 0.4
45 0.41
46 0.42
47 0.45
48 0.45
49 0.43
50 0.41
51 0.39
52 0.37
53 0.44
54 0.48
55 0.44
56 0.42
57 0.36
58 0.33
59 0.32
60 0.26
61 0.16
62 0.12
63 0.12
64 0.11
65 0.11
66 0.1
67 0.04
68 0.03
69 0.03
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.08
84 0.08
85 0.09
86 0.13
87 0.14
88 0.15
89 0.18
90 0.19
91 0.23
92 0.32
93 0.4
94 0.45
95 0.47
96 0.46
97 0.44
98 0.44
99 0.39
100 0.37
101 0.29
102 0.22
103 0.21
104 0.23
105 0.24
106 0.23
107 0.24
108 0.19
109 0.19