Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M7ATT6

Protein Details
Accession A0A3M7ATT6    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
32-53LGIARGKTAKRHRKVLRDNIQGHydrophilic
NLS Segment(s)
PositionSequence
20-51RGKTLGGKGGKGLGIARGKTAKRHRKVLRDNI
55-67TRPDIRRLARRGG
Subcellular Location(s) mito 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR001951  Histone_H4  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Amino Acid Sequences MARQLVRSDVSGSQALPSGRGKTLGGKGGKGLGIARGKTAKRHRKVLRDNIQGITRPDIRRLARRGGVKRVSAHIYDDVRQVLRAHLERVLRDVCAVVETCGRKTVCTSDVVFTLQRLGRTLYSVIHGSAAVLMPGRDSEIQSAKGSATVVVDRMAARIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.19
4 0.2
5 0.2
6 0.19
7 0.21
8 0.21
9 0.23
10 0.28
11 0.32
12 0.31
13 0.28
14 0.29
15 0.29
16 0.29
17 0.23
18 0.19
19 0.18
20 0.21
21 0.21
22 0.23
23 0.26
24 0.27
25 0.35
26 0.46
27 0.5
28 0.51
29 0.62
30 0.66
31 0.71
32 0.8
33 0.82
34 0.82
35 0.8
36 0.77
37 0.7
38 0.64
39 0.57
40 0.48
41 0.42
42 0.38
43 0.3
44 0.29
45 0.33
46 0.33
47 0.38
48 0.4
49 0.41
50 0.4
51 0.47
52 0.49
53 0.51
54 0.52
55 0.48
56 0.45
57 0.43
58 0.4
59 0.33
60 0.3
61 0.26
62 0.23
63 0.21
64 0.2
65 0.18
66 0.15
67 0.16
68 0.14
69 0.1
70 0.13
71 0.12
72 0.12
73 0.15
74 0.16
75 0.15
76 0.18
77 0.18
78 0.15
79 0.14
80 0.13
81 0.09
82 0.09
83 0.09
84 0.07
85 0.1
86 0.12
87 0.12
88 0.17
89 0.17
90 0.16
91 0.17
92 0.2
93 0.18
94 0.2
95 0.21
96 0.18
97 0.19
98 0.2
99 0.19
100 0.15
101 0.19
102 0.17
103 0.16
104 0.16
105 0.17
106 0.16
107 0.18
108 0.18
109 0.14
110 0.16
111 0.16
112 0.15
113 0.13
114 0.12
115 0.1
116 0.1
117 0.09
118 0.07
119 0.07
120 0.06
121 0.06
122 0.06
123 0.09
124 0.09
125 0.1
126 0.14
127 0.18
128 0.21
129 0.21
130 0.22
131 0.2
132 0.2
133 0.19
134 0.15
135 0.14
136 0.13
137 0.13
138 0.12
139 0.14
140 0.13