Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6Z5K6

Protein Details
Accession A0A3M6Z5K6    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
33-54LSHHPDKLRERQKKDANRPALSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001623  DnaJ_domain  
IPR044248  DPH3/4-like  
IPR007872  DPH_MB_dom  
IPR036671  DPH_MB_sf  
IPR036869  J_dom_sf  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0046872  F:metal ion binding  
GO:0017183  P:peptidyl-diphthamide biosynthetic process from peptidyl-histidine  
Pfam View protein in Pfam  
PF00226  DnaJ  
PF05207  zf-CSL  
PROSITE View protein in PROSITE  
PS50076  DNAJ_2  
PS51074  DPH_MB  
CDD cd06257  DnaJ  
Amino Acid Sequences MSNHYERLGLASRPRDGTLSAEAIKQAYRQALLSHHPDKLRERQKKDANRPALSVDQITFAYKVLSDPELRAEYDLALLHEASNDPEHGRVHQTGLETVDLDALEFQDESETWTRSCRCGDPKGFVVSEPELEKHIDEGELTVGCRGCSLWLRVLFSVED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.33
3 0.3
4 0.3
5 0.27
6 0.26
7 0.24
8 0.22
9 0.22
10 0.21
11 0.21
12 0.18
13 0.17
14 0.14
15 0.14
16 0.14
17 0.15
18 0.18
19 0.21
20 0.28
21 0.29
22 0.31
23 0.32
24 0.34
25 0.38
26 0.45
27 0.51
28 0.54
29 0.57
30 0.63
31 0.71
32 0.78
33 0.84
34 0.83
35 0.81
36 0.73
37 0.68
38 0.61
39 0.54
40 0.44
41 0.35
42 0.25
43 0.18
44 0.16
45 0.15
46 0.12
47 0.1
48 0.09
49 0.08
50 0.07
51 0.07
52 0.09
53 0.08
54 0.09
55 0.12
56 0.13
57 0.13
58 0.13
59 0.11
60 0.1
61 0.1
62 0.1
63 0.07
64 0.06
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.06
71 0.06
72 0.06
73 0.07
74 0.08
75 0.09
76 0.11
77 0.11
78 0.12
79 0.13
80 0.13
81 0.13
82 0.14
83 0.13
84 0.1
85 0.1
86 0.1
87 0.08
88 0.07
89 0.06
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.08
97 0.11
98 0.12
99 0.11
100 0.16
101 0.18
102 0.2
103 0.22
104 0.25
105 0.29
106 0.37
107 0.4
108 0.41
109 0.44
110 0.47
111 0.44
112 0.38
113 0.37
114 0.29
115 0.28
116 0.24
117 0.21
118 0.18
119 0.18
120 0.18
121 0.15
122 0.14
123 0.11
124 0.1
125 0.1
126 0.1
127 0.1
128 0.1
129 0.12
130 0.12
131 0.11
132 0.11
133 0.11
134 0.12
135 0.16
136 0.2
137 0.24
138 0.28
139 0.32
140 0.32