Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6XMR1

Protein Details
Accession A0A3M6XMR1    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
22-47GPSNSAAEQKKPRPRKRGPNYAQIHAHydrophilic
NLS Segment(s)
PositionSequence
31-39KKPRPRKRG
142-148ERAKRKG
163-178REERRLFKLERARAER
Subcellular Location(s) nucl 19.5, cyto_nucl 12.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006676  tRNA_splic  
Gene Ontology GO:0000213  F:tRNA-intron endonuclease activity  
GO:0006388  P:tRNA splicing, via endonucleolytic cleavage and ligation  
Amino Acid Sequences MAAAVANNGPSPPGPAENPANGPSNSAAEQKKPRPRKRGPNYAQIHAKPLPLEVHPLPAFHPSHPLSLLHLCYIYLQQLVSPPSSHPDTPYAGYFSPETRSVHVTDPATVRALWEMGFFGKGALSRSEPSWLEREKARLLAERAKRKGGVSGGTAEEATMARREERRLFKLERARAERERIERQRAVEEGRMSREEFDRLEAEAEAIDTGTTRAVAEAAVAAAKKAGSTEQATQPQPRVPDAEIIEPRAAQPDDSTAPPD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.22
3 0.27
4 0.3
5 0.33
6 0.32
7 0.35
8 0.31
9 0.32
10 0.28
11 0.26
12 0.25
13 0.28
14 0.27
15 0.31
16 0.4
17 0.47
18 0.57
19 0.64
20 0.72
21 0.76
22 0.84
23 0.88
24 0.89
25 0.91
26 0.87
27 0.87
28 0.83
29 0.8
30 0.79
31 0.68
32 0.64
33 0.54
34 0.5
35 0.39
36 0.36
37 0.3
38 0.22
39 0.27
40 0.21
41 0.26
42 0.25
43 0.25
44 0.24
45 0.27
46 0.28
47 0.22
48 0.29
49 0.23
50 0.25
51 0.25
52 0.25
53 0.22
54 0.24
55 0.25
56 0.18
57 0.17
58 0.15
59 0.15
60 0.15
61 0.12
62 0.09
63 0.08
64 0.08
65 0.11
66 0.12
67 0.12
68 0.12
69 0.12
70 0.15
71 0.18
72 0.18
73 0.17
74 0.18
75 0.2
76 0.2
77 0.21
78 0.2
79 0.17
80 0.18
81 0.17
82 0.15
83 0.15
84 0.17
85 0.16
86 0.16
87 0.18
88 0.18
89 0.2
90 0.22
91 0.2
92 0.2
93 0.2
94 0.19
95 0.18
96 0.16
97 0.14
98 0.11
99 0.1
100 0.08
101 0.07
102 0.06
103 0.05
104 0.06
105 0.05
106 0.05
107 0.05
108 0.06
109 0.07
110 0.08
111 0.09
112 0.09
113 0.1
114 0.13
115 0.13
116 0.14
117 0.18
118 0.17
119 0.18
120 0.18
121 0.21
122 0.19
123 0.21
124 0.21
125 0.2
126 0.22
127 0.28
128 0.34
129 0.4
130 0.41
131 0.41
132 0.4
133 0.37
134 0.38
135 0.32
136 0.26
137 0.19
138 0.19
139 0.18
140 0.17
141 0.16
142 0.13
143 0.11
144 0.09
145 0.08
146 0.07
147 0.07
148 0.09
149 0.11
150 0.15
151 0.22
152 0.29
153 0.33
154 0.38
155 0.4
156 0.46
157 0.53
158 0.55
159 0.56
160 0.55
161 0.58
162 0.55
163 0.58
164 0.57
165 0.54
166 0.59
167 0.57
168 0.58
169 0.54
170 0.52
171 0.5
172 0.46
173 0.43
174 0.38
175 0.36
176 0.31
177 0.32
178 0.31
179 0.28
180 0.28
181 0.26
182 0.24
183 0.2
184 0.21
185 0.18
186 0.17
187 0.17
188 0.15
189 0.13
190 0.11
191 0.1
192 0.07
193 0.06
194 0.05
195 0.04
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.06
207 0.06
208 0.06
209 0.06
210 0.06
211 0.06
212 0.07
213 0.08
214 0.1
215 0.14
216 0.2
217 0.27
218 0.34
219 0.38
220 0.41
221 0.43
222 0.43
223 0.42
224 0.39
225 0.35
226 0.29
227 0.33
228 0.32
229 0.37
230 0.36
231 0.38
232 0.36
233 0.33
234 0.32
235 0.31
236 0.28
237 0.2
238 0.18
239 0.21
240 0.23