Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M7B4N7

Protein Details
Accession A0A3M7B4N7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
322-347LVLLRFCLKWRQQRRLRNKTYRPASPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, extr 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR007577  GlycoTrfase_DXD_sugar-bd_CS  
IPR029044  Nucleotide-diphossugar_trans  
Gene Ontology GO:0016020  C:membrane  
GO:1901135  P:carbohydrate derivative metabolic process  
Pfam View protein in Pfam  
PF04488  Gly_transf_sug  
Amino Acid Sequences MWLPRPLRLVFLVLLVVLVILYPIWRQYSYERSLTASSISFADFPPDYADALKQAQRENKNPEYDWPPLPSPPPEAQTTIPPIIHFIWFRDLYHEHLDISEIPHIGSQAPQQCMEHNPDYEVITWNETAARALVEEHYSWLLPLYDGYRYPIQRIDAFKYVVLWHYGGVYMDLDIACRRKLDPLLPFAAWYPKASPFGVNNDLMASRARHPFIGYMLKQLAPRNWNLLFPYLTIFWSTGPQFTSDMLAAWFWYYPPPFYPPGDKKLEFGPDTVFVLPQEFYSEQYTFFGHSPGGTWHGPDVAVVLWIVDHPWVLVVFAVVCLVLLRFCLKWRQQRRLRNKTYRPASP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.11
3 0.09
4 0.05
5 0.04
6 0.03
7 0.03
8 0.03
9 0.04
10 0.06
11 0.09
12 0.1
13 0.13
14 0.18
15 0.27
16 0.32
17 0.35
18 0.34
19 0.35
20 0.36
21 0.34
22 0.31
23 0.23
24 0.19
25 0.16
26 0.16
27 0.14
28 0.12
29 0.16
30 0.13
31 0.14
32 0.16
33 0.16
34 0.15
35 0.15
36 0.16
37 0.15
38 0.19
39 0.21
40 0.2
41 0.25
42 0.33
43 0.39
44 0.46
45 0.52
46 0.55
47 0.58
48 0.56
49 0.56
50 0.54
51 0.51
52 0.47
53 0.43
54 0.38
55 0.35
56 0.37
57 0.33
58 0.33
59 0.32
60 0.32
61 0.29
62 0.3
63 0.29
64 0.31
65 0.34
66 0.31
67 0.28
68 0.25
69 0.25
70 0.24
71 0.25
72 0.21
73 0.17
74 0.21
75 0.21
76 0.22
77 0.24
78 0.24
79 0.25
80 0.29
81 0.27
82 0.21
83 0.2
84 0.21
85 0.17
86 0.18
87 0.16
88 0.11
89 0.11
90 0.11
91 0.11
92 0.1
93 0.11
94 0.14
95 0.17
96 0.19
97 0.2
98 0.2
99 0.21
100 0.23
101 0.29
102 0.26
103 0.21
104 0.21
105 0.21
106 0.21
107 0.21
108 0.21
109 0.15
110 0.14
111 0.13
112 0.12
113 0.12
114 0.11
115 0.1
116 0.07
117 0.07
118 0.05
119 0.06
120 0.07
121 0.07
122 0.07
123 0.08
124 0.09
125 0.08
126 0.08
127 0.08
128 0.07
129 0.06
130 0.06
131 0.06
132 0.07
133 0.07
134 0.11
135 0.15
136 0.15
137 0.16
138 0.18
139 0.19
140 0.22
141 0.25
142 0.26
143 0.25
144 0.25
145 0.24
146 0.22
147 0.21
148 0.18
149 0.16
150 0.11
151 0.08
152 0.08
153 0.08
154 0.07
155 0.07
156 0.06
157 0.04
158 0.05
159 0.05
160 0.05
161 0.06
162 0.07
163 0.07
164 0.07
165 0.08
166 0.1
167 0.12
168 0.16
169 0.18
170 0.21
171 0.23
172 0.23
173 0.23
174 0.21
175 0.23
176 0.19
177 0.16
178 0.15
179 0.14
180 0.17
181 0.17
182 0.18
183 0.16
184 0.21
185 0.24
186 0.22
187 0.19
188 0.17
189 0.17
190 0.16
191 0.15
192 0.12
193 0.12
194 0.15
195 0.16
196 0.15
197 0.16
198 0.16
199 0.19
200 0.24
201 0.21
202 0.22
203 0.23
204 0.24
205 0.26
206 0.28
207 0.28
208 0.23
209 0.24
210 0.26
211 0.25
212 0.25
213 0.24
214 0.24
215 0.2
216 0.18
217 0.19
218 0.14
219 0.14
220 0.13
221 0.12
222 0.1
223 0.12
224 0.12
225 0.12
226 0.12
227 0.13
228 0.13
229 0.13
230 0.14
231 0.11
232 0.11
233 0.1
234 0.09
235 0.08
236 0.07
237 0.07
238 0.06
239 0.09
240 0.1
241 0.1
242 0.12
243 0.16
244 0.19
245 0.21
246 0.3
247 0.32
248 0.38
249 0.45
250 0.44
251 0.41
252 0.43
253 0.48
254 0.39
255 0.35
256 0.3
257 0.24
258 0.26
259 0.25
260 0.2
261 0.14
262 0.14
263 0.13
264 0.11
265 0.14
266 0.12
267 0.14
268 0.18
269 0.18
270 0.17
271 0.18
272 0.19
273 0.17
274 0.17
275 0.15
276 0.11
277 0.11
278 0.12
279 0.13
280 0.17
281 0.15
282 0.15
283 0.15
284 0.16
285 0.15
286 0.14
287 0.13
288 0.08
289 0.08
290 0.07
291 0.06
292 0.05
293 0.05
294 0.06
295 0.05
296 0.05
297 0.04
298 0.06
299 0.06
300 0.06
301 0.06
302 0.06
303 0.06
304 0.06
305 0.06
306 0.05
307 0.05
308 0.05
309 0.05
310 0.05
311 0.06
312 0.08
313 0.09
314 0.12
315 0.22
316 0.3
317 0.4
318 0.51
319 0.61
320 0.68
321 0.79
322 0.87
323 0.89
324 0.92
325 0.93
326 0.93
327 0.93