Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M6ZNZ1

Protein Details
Accession A0A3M6ZNZ1    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
223-246LDELLNQKASKKSKKKNKSKPAGAHydrophilic
NLS Segment(s)
PositionSequence
155-161KSKKRKA
230-246KASKKSKKKNKSKPAGA
Subcellular Location(s) nucl 21.5, cyto_nucl 13.833, mito_nucl 12.166, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021641  DUF3245  
Pfam View protein in Pfam  
PF11595  DUF3245  
Amino Acid Sequences MIHTLTMAKPNNEPSEADVILNRTNVALARSQRLIQSWLPPKPSEESAAAQSTPAEDDEEDFKGLDETAGIGSKRKAEDEGVPDGALRRKKLGSNDKLLEQILGKKAAQQKKKQDASKNSLKASLPAKQMPAQPTKPQQPDSEEEEEEGRAAAFKSKKRKANPPVTRPAEPPIRDATAQERTNTEQGMQKSHSAAHEAAEPPSANEKDTDDERPAKRKTGSYLDELLNQKASKKSKKKNKSKPAGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.34
4 0.31
5 0.26
6 0.24
7 0.25
8 0.24
9 0.2
10 0.14
11 0.14
12 0.14
13 0.14
14 0.17
15 0.18
16 0.22
17 0.24
18 0.26
19 0.27
20 0.28
21 0.3
22 0.27
23 0.34
24 0.37
25 0.4
26 0.42
27 0.41
28 0.42
29 0.42
30 0.41
31 0.35
32 0.3
33 0.28
34 0.28
35 0.3
36 0.27
37 0.23
38 0.21
39 0.17
40 0.15
41 0.13
42 0.1
43 0.07
44 0.09
45 0.12
46 0.13
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.09
53 0.06
54 0.05
55 0.06
56 0.08
57 0.08
58 0.09
59 0.1
60 0.14
61 0.15
62 0.15
63 0.16
64 0.16
65 0.21
66 0.24
67 0.27
68 0.24
69 0.23
70 0.22
71 0.23
72 0.25
73 0.23
74 0.2
75 0.18
76 0.2
77 0.23
78 0.32
79 0.41
80 0.42
81 0.47
82 0.49
83 0.47
84 0.47
85 0.43
86 0.35
87 0.25
88 0.23
89 0.17
90 0.16
91 0.15
92 0.18
93 0.26
94 0.32
95 0.38
96 0.42
97 0.5
98 0.58
99 0.66
100 0.68
101 0.69
102 0.7
103 0.7
104 0.72
105 0.66
106 0.57
107 0.53
108 0.47
109 0.42
110 0.36
111 0.34
112 0.28
113 0.25
114 0.26
115 0.26
116 0.29
117 0.3
118 0.34
119 0.3
120 0.32
121 0.37
122 0.43
123 0.44
124 0.43
125 0.4
126 0.39
127 0.4
128 0.41
129 0.39
130 0.31
131 0.28
132 0.26
133 0.24
134 0.2
135 0.16
136 0.09
137 0.06
138 0.06
139 0.1
140 0.14
141 0.19
142 0.3
143 0.37
144 0.45
145 0.5
146 0.61
147 0.66
148 0.73
149 0.78
150 0.77
151 0.8
152 0.78
153 0.75
154 0.66
155 0.62
156 0.59
157 0.49
158 0.44
159 0.37
160 0.34
161 0.31
162 0.31
163 0.31
164 0.31
165 0.32
166 0.3
167 0.29
168 0.29
169 0.31
170 0.3
171 0.26
172 0.22
173 0.23
174 0.27
175 0.26
176 0.24
177 0.23
178 0.25
179 0.24
180 0.23
181 0.21
182 0.17
183 0.21
184 0.2
185 0.2
186 0.2
187 0.19
188 0.17
189 0.24
190 0.24
191 0.19
192 0.19
193 0.2
194 0.22
195 0.25
196 0.28
197 0.26
198 0.34
199 0.38
200 0.45
201 0.46
202 0.48
203 0.49
204 0.5
205 0.51
206 0.53
207 0.52
208 0.49
209 0.52
210 0.47
211 0.5
212 0.48
213 0.43
214 0.38
215 0.35
216 0.34
217 0.36
218 0.43
219 0.47
220 0.55
221 0.64
222 0.7
223 0.81
224 0.88
225 0.92
226 0.94