Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M7BQL9

Protein Details
Accession A0A3M7BQL9    Localization Confidence High Confidence Score 15.6
NoLS Segment(s)
PositionSequenceProtein Nature
60-85YTENSRKPLRSAKRSKFKSWSRYMKGHydrophilic
NLS Segment(s)
PositionSequence
69-74RSAKRS
303-305AKR
Subcellular Location(s) nucl 14, cyto 7, pero 4
Family & Domain DBs
Amino Acid Sequences MELSLYLCQDEVTQLDQAFNISLQHDSELVFWTGISPGLACDWARRNGLKTLTMAMGNLYTENSRKPLRSAKRSKFKSWSRYMKGASWIFAQHACQGRRAIVLTNAPPDVYSKRKHSSYREIEEPILKGFEAGQRTNQIDYVHPQIPGAAGFRYQVWPKDWSAEWFGFLECIAIKDIVRRFVQRPRVRRLEKVEEAESVSIIGHQRSTFFATVVEKSNRIVQEKNLTKVHNVEMQQLAAQQATQDRKIGKRLKLEKEQQAAQDKRAAKRLKLEQEQQAAQDKRAAKRLKLEQEQQAAQDKRAAKRLKLEKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.15
4 0.15
5 0.14
6 0.13
7 0.12
8 0.1
9 0.11
10 0.11
11 0.12
12 0.12
13 0.12
14 0.12
15 0.14
16 0.14
17 0.12
18 0.11
19 0.11
20 0.11
21 0.11
22 0.1
23 0.07
24 0.06
25 0.07
26 0.1
27 0.09
28 0.14
29 0.19
30 0.23
31 0.27
32 0.29
33 0.31
34 0.36
35 0.39
36 0.36
37 0.33
38 0.32
39 0.29
40 0.27
41 0.24
42 0.18
43 0.15
44 0.13
45 0.12
46 0.09
47 0.09
48 0.1
49 0.12
50 0.16
51 0.19
52 0.2
53 0.24
54 0.34
55 0.42
56 0.52
57 0.61
58 0.67
59 0.75
60 0.8
61 0.83
62 0.83
63 0.82
64 0.81
65 0.81
66 0.81
67 0.76
68 0.77
69 0.72
70 0.66
71 0.65
72 0.56
73 0.47
74 0.39
75 0.33
76 0.27
77 0.25
78 0.22
79 0.19
80 0.25
81 0.25
82 0.26
83 0.26
84 0.25
85 0.26
86 0.26
87 0.22
88 0.17
89 0.21
90 0.19
91 0.21
92 0.2
93 0.18
94 0.18
95 0.18
96 0.19
97 0.2
98 0.22
99 0.26
100 0.32
101 0.37
102 0.43
103 0.48
104 0.54
105 0.58
106 0.6
107 0.58
108 0.55
109 0.51
110 0.47
111 0.41
112 0.31
113 0.22
114 0.16
115 0.12
116 0.1
117 0.12
118 0.13
119 0.13
120 0.14
121 0.17
122 0.18
123 0.19
124 0.19
125 0.17
126 0.15
127 0.16
128 0.2
129 0.18
130 0.17
131 0.17
132 0.15
133 0.14
134 0.14
135 0.12
136 0.07
137 0.06
138 0.06
139 0.07
140 0.09
141 0.1
142 0.12
143 0.13
144 0.15
145 0.15
146 0.18
147 0.18
148 0.18
149 0.21
150 0.19
151 0.17
152 0.15
153 0.15
154 0.12
155 0.11
156 0.09
157 0.05
158 0.06
159 0.06
160 0.06
161 0.06
162 0.1
163 0.12
164 0.16
165 0.17
166 0.2
167 0.22
168 0.29
169 0.4
170 0.42
171 0.48
172 0.52
173 0.61
174 0.61
175 0.65
176 0.65
177 0.64
178 0.62
179 0.6
180 0.53
181 0.44
182 0.42
183 0.35
184 0.27
185 0.18
186 0.12
187 0.09
188 0.09
189 0.08
190 0.08
191 0.08
192 0.09
193 0.1
194 0.14
195 0.13
196 0.12
197 0.14
198 0.15
199 0.17
200 0.22
201 0.22
202 0.19
203 0.2
204 0.25
205 0.26
206 0.26
207 0.26
208 0.24
209 0.33
210 0.38
211 0.42
212 0.41
213 0.4
214 0.39
215 0.4
216 0.39
217 0.34
218 0.3
219 0.29
220 0.26
221 0.26
222 0.25
223 0.22
224 0.19
225 0.13
226 0.12
227 0.09
228 0.14
229 0.17
230 0.17
231 0.2
232 0.23
233 0.27
234 0.36
235 0.43
236 0.44
237 0.5
238 0.59
239 0.64
240 0.7
241 0.76
242 0.75
243 0.74
244 0.72
245 0.68
246 0.69
247 0.63
248 0.55
249 0.54
250 0.5
251 0.48
252 0.53
253 0.51
254 0.44
255 0.51
256 0.58
257 0.61
258 0.64
259 0.67
260 0.66
261 0.68
262 0.67
263 0.61
264 0.61
265 0.53
266 0.46
267 0.45
268 0.42
269 0.39
270 0.46
271 0.47
272 0.41
273 0.48
274 0.57
275 0.61
276 0.64
277 0.67
278 0.66
279 0.68
280 0.67
281 0.61
282 0.61
283 0.53
284 0.46
285 0.45
286 0.42
287 0.39
288 0.46
289 0.47
290 0.41
291 0.49