Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M6Y8T0

Protein Details
Accession A0A3M6Y8T0    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAPVRKTRKEPTRRSERLELSKAHydrophilic
31-62LKIKIKRSDTRIRKSFRRPKQHKTCRLLQLPGHydrophilic
NLS Segment(s)
PositionSequence
5-51RKTRKEPTRRSERLELSKAIEASKENLKIKIKRSDTRIRKSFRRPKQ
Subcellular Location(s) nucl 14.5, cyto_nucl 11, cyto 6.5, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
Amino Acid Sequences MAPVRKTRKEPTRRSERLELSKAIEASKENLKIKIKRSDTRIRKSFRRPKQHKTCRLLQLPGELRNQIYRYALVSDKAIEIKPTGPGEPPLLSTCVTIRRETKGIYYPENNFRLLLTDYNGSAFSDFYWQSRLWQFRRHSAAKNITFQLGGRPNWANLVEWIKDGYYGCGPPLRPDLDEPKCRDDFVVGAAFRIAEEMEFKVCWVTIEKALEAYHWGLKGTCSRWASDGESGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.83
4 0.82
5 0.77
6 0.69
7 0.62
8 0.6
9 0.53
10 0.44
11 0.36
12 0.28
13 0.26
14 0.3
15 0.32
16 0.3
17 0.35
18 0.43
19 0.47
20 0.53
21 0.59
22 0.6
23 0.59
24 0.65
25 0.7
26 0.72
27 0.77
28 0.78
29 0.76
30 0.77
31 0.82
32 0.84
33 0.84
34 0.85
35 0.83
36 0.85
37 0.89
38 0.91
39 0.9
40 0.87
41 0.86
42 0.84
43 0.81
44 0.74
45 0.65
46 0.63
47 0.57
48 0.55
49 0.48
50 0.39
51 0.34
52 0.33
53 0.33
54 0.25
55 0.21
56 0.17
57 0.15
58 0.17
59 0.18
60 0.14
61 0.14
62 0.13
63 0.13
64 0.15
65 0.13
66 0.11
67 0.11
68 0.11
69 0.14
70 0.14
71 0.14
72 0.13
73 0.14
74 0.16
75 0.15
76 0.16
77 0.14
78 0.14
79 0.14
80 0.13
81 0.13
82 0.18
83 0.19
84 0.2
85 0.2
86 0.22
87 0.24
88 0.24
89 0.26
90 0.25
91 0.26
92 0.28
93 0.29
94 0.3
95 0.35
96 0.36
97 0.33
98 0.27
99 0.24
100 0.23
101 0.2
102 0.17
103 0.11
104 0.1
105 0.1
106 0.1
107 0.1
108 0.08
109 0.07
110 0.07
111 0.05
112 0.08
113 0.08
114 0.08
115 0.11
116 0.11
117 0.13
118 0.18
119 0.25
120 0.24
121 0.32
122 0.34
123 0.39
124 0.46
125 0.47
126 0.47
127 0.49
128 0.56
129 0.52
130 0.54
131 0.48
132 0.41
133 0.37
134 0.32
135 0.31
136 0.27
137 0.24
138 0.23
139 0.22
140 0.22
141 0.24
142 0.25
143 0.18
144 0.15
145 0.19
146 0.16
147 0.15
148 0.16
149 0.13
150 0.14
151 0.14
152 0.13
153 0.12
154 0.11
155 0.12
156 0.15
157 0.15
158 0.17
159 0.21
160 0.21
161 0.2
162 0.24
163 0.32
164 0.37
165 0.44
166 0.46
167 0.48
168 0.46
169 0.45
170 0.42
171 0.34
172 0.27
173 0.23
174 0.25
175 0.18
176 0.18
177 0.17
178 0.17
179 0.15
180 0.15
181 0.11
182 0.05
183 0.07
184 0.08
185 0.09
186 0.09
187 0.1
188 0.1
189 0.1
190 0.11
191 0.13
192 0.15
193 0.18
194 0.21
195 0.21
196 0.22
197 0.22
198 0.22
199 0.21
200 0.2
201 0.19
202 0.17
203 0.17
204 0.16
205 0.19
206 0.25
207 0.24
208 0.3
209 0.28
210 0.29
211 0.3
212 0.34
213 0.35