Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M7BT78

Protein Details
Accession A0A3M7BT78    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-29PAAAGAKKGKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
7-23GAKKGKKKWSKGKVKDK
Subcellular Location(s) cyto 11, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAGAKKGKKKWSKGKVKDKAQHAVVLDKQTNERLNKDVQSYRLITVAVLVDRLKINGSLARKALSELEEKGVIRKVVSHNALNIYTRAVGGGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.78
3 0.82
4 0.85
5 0.91
6 0.91
7 0.92
8 0.89
9 0.85
10 0.82
11 0.72
12 0.65
13 0.55
14 0.5
15 0.42
16 0.4
17 0.34
18 0.28
19 0.27
20 0.27
21 0.31
22 0.28
23 0.27
24 0.24
25 0.26
26 0.27
27 0.3
28 0.28
29 0.25
30 0.27
31 0.26
32 0.24
33 0.22
34 0.19
35 0.15
36 0.13
37 0.11
38 0.08
39 0.07
40 0.06
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.08
47 0.1
48 0.13
49 0.14
50 0.15
51 0.16
52 0.16
53 0.16
54 0.17
55 0.16
56 0.16
57 0.15
58 0.17
59 0.18
60 0.18
61 0.2
62 0.21
63 0.19
64 0.17
65 0.2
66 0.22
67 0.28
68 0.33
69 0.32
70 0.32
71 0.36
72 0.37
73 0.34
74 0.3
75 0.24
76 0.2
77 0.18