Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3M6ZGK2

Protein Details
Accession A0A3M6ZGK2    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
88-116DGENGSKSKDKKKDRRSRKYVDRPNFSIPBasic
447-471AQQTTTTKGKKNGKSKGGRDPPKSGHydrophilic
479-503ASVGRGEWRRRRWVRMVERRPSPDAHydrophilic
NLS Segment(s)
PositionSequence
94-106KSKDKKKDRRSRK
454-498KGKKNGKSKGGRDPPKSGWEEGGPGASVGRGEWRRRRWVRMVERR
Subcellular Location(s) plas 17, nucl 4, E.R. 2, mito 1, cyto 1, golg 1, vacu 1, cyto_mito 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR010482  Peroxin  
Gene Ontology GO:0005778  C:peroxisomal membrane  
GO:0007031  P:peroxisome organization  
Pfam View protein in Pfam  
PF06398  Pex24p  
Amino Acid Sequences MDDQDSIVNRDEAIPIFRLPSQDSEPNDAASTSETEQQYGAREILRGHASKIRDKWDEYSGQSLQDRFFTGLMSHIVPPEELSENEEDGENGSKSKDKKKDRRSRKYVDRPNFSIPLMSANFRRFNARVGVLFVLENRLIHLFTWKHQTATASFLAVYTLVCLQPHLLPAVPLALMLFWVMVPSFLARHPASSNDPRVEPSYRGPPMAPPSRVKPAPEMSKDFFRNMRDLQNSMEDFSRLHDAANEYITPYTNFSDEGTSSLLFIALFGISCSAFIASGLVPWKFVALVAGWVCTLSGHPEAQRIMLSSINLSQIRQRIENLQTHLMNFVQHDVILGEPSEARQVEIFELQKFHSSSETWESWLFSPSPFDPLSPIRIAGDRAKGTQFFEDVSPPSGWVWKDKKWILDLFSREWVEQRMIYGVEIETEGERWVYDLPQEEVAQLADAQQTTTTKGKKNGKSKGGRDPPKSGWEEGGPGASVGRGEWRRRRWVRMVERRPSPDAG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.19
4 0.21
5 0.22
6 0.22
7 0.26
8 0.29
9 0.33
10 0.36
11 0.41
12 0.41
13 0.4
14 0.38
15 0.32
16 0.27
17 0.22
18 0.22
19 0.16
20 0.22
21 0.2
22 0.2
23 0.21
24 0.22
25 0.23
26 0.22
27 0.22
28 0.16
29 0.18
30 0.18
31 0.23
32 0.28
33 0.25
34 0.26
35 0.3
36 0.32
37 0.39
38 0.44
39 0.46
40 0.45
41 0.47
42 0.48
43 0.5
44 0.51
45 0.46
46 0.47
47 0.4
48 0.39
49 0.39
50 0.37
51 0.31
52 0.28
53 0.27
54 0.22
55 0.2
56 0.17
57 0.14
58 0.15
59 0.16
60 0.16
61 0.15
62 0.15
63 0.15
64 0.14
65 0.15
66 0.15
67 0.15
68 0.13
69 0.16
70 0.17
71 0.17
72 0.17
73 0.17
74 0.13
75 0.13
76 0.15
77 0.13
78 0.11
79 0.12
80 0.16
81 0.21
82 0.31
83 0.39
84 0.47
85 0.58
86 0.69
87 0.79
88 0.85
89 0.92
90 0.92
91 0.93
92 0.93
93 0.94
94 0.93
95 0.92
96 0.89
97 0.83
98 0.8
99 0.72
100 0.6
101 0.51
102 0.4
103 0.36
104 0.29
105 0.26
106 0.24
107 0.26
108 0.29
109 0.28
110 0.33
111 0.28
112 0.29
113 0.32
114 0.31
115 0.27
116 0.26
117 0.26
118 0.21
119 0.21
120 0.18
121 0.16
122 0.13
123 0.12
124 0.1
125 0.1
126 0.1
127 0.1
128 0.16
129 0.14
130 0.17
131 0.26
132 0.25
133 0.25
134 0.26
135 0.28
136 0.23
137 0.26
138 0.24
139 0.16
140 0.15
141 0.15
142 0.13
143 0.11
144 0.1
145 0.06
146 0.07
147 0.06
148 0.06
149 0.07
150 0.08
151 0.09
152 0.1
153 0.1
154 0.08
155 0.08
156 0.08
157 0.09
158 0.08
159 0.07
160 0.06
161 0.04
162 0.04
163 0.04
164 0.04
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.04
171 0.05
172 0.05
173 0.1
174 0.1
175 0.12
176 0.13
177 0.16
178 0.22
179 0.27
180 0.32
181 0.29
182 0.29
183 0.29
184 0.32
185 0.31
186 0.27
187 0.25
188 0.28
189 0.27
190 0.27
191 0.26
192 0.26
193 0.31
194 0.35
195 0.35
196 0.3
197 0.33
198 0.39
199 0.4
200 0.38
201 0.35
202 0.36
203 0.4
204 0.41
205 0.43
206 0.38
207 0.43
208 0.44
209 0.41
210 0.38
211 0.32
212 0.32
213 0.29
214 0.33
215 0.27
216 0.27
217 0.26
218 0.28
219 0.26
220 0.23
221 0.22
222 0.15
223 0.13
224 0.14
225 0.15
226 0.1
227 0.1
228 0.1
229 0.11
230 0.12
231 0.12
232 0.11
233 0.09
234 0.09
235 0.09
236 0.08
237 0.08
238 0.08
239 0.07
240 0.08
241 0.08
242 0.09
243 0.08
244 0.09
245 0.09
246 0.08
247 0.08
248 0.08
249 0.07
250 0.06
251 0.06
252 0.05
253 0.03
254 0.03
255 0.03
256 0.04
257 0.03
258 0.04
259 0.04
260 0.03
261 0.03
262 0.03
263 0.04
264 0.04
265 0.05
266 0.07
267 0.07
268 0.07
269 0.07
270 0.07
271 0.06
272 0.06
273 0.06
274 0.04
275 0.07
276 0.07
277 0.07
278 0.07
279 0.07
280 0.07
281 0.06
282 0.06
283 0.06
284 0.08
285 0.08
286 0.09
287 0.12
288 0.12
289 0.13
290 0.13
291 0.12
292 0.11
293 0.11
294 0.11
295 0.09
296 0.1
297 0.14
298 0.14
299 0.13
300 0.15
301 0.18
302 0.2
303 0.21
304 0.21
305 0.22
306 0.27
307 0.31
308 0.32
309 0.33
310 0.31
311 0.3
312 0.3
313 0.25
314 0.21
315 0.16
316 0.14
317 0.09
318 0.08
319 0.08
320 0.07
321 0.07
322 0.07
323 0.07
324 0.05
325 0.05
326 0.06
327 0.09
328 0.08
329 0.09
330 0.09
331 0.09
332 0.1
333 0.14
334 0.16
335 0.14
336 0.15
337 0.16
338 0.19
339 0.19
340 0.18
341 0.17
342 0.15
343 0.18
344 0.23
345 0.23
346 0.2
347 0.21
348 0.22
349 0.21
350 0.23
351 0.2
352 0.14
353 0.16
354 0.15
355 0.19
356 0.17
357 0.16
358 0.18
359 0.19
360 0.24
361 0.21
362 0.21
363 0.18
364 0.19
365 0.22
366 0.22
367 0.27
368 0.24
369 0.25
370 0.28
371 0.28
372 0.28
373 0.27
374 0.23
375 0.18
376 0.18
377 0.18
378 0.17
379 0.19
380 0.17
381 0.16
382 0.16
383 0.19
384 0.18
385 0.24
386 0.28
387 0.3
388 0.39
389 0.41
390 0.45
391 0.46
392 0.49
393 0.44
394 0.46
395 0.45
396 0.4
397 0.43
398 0.41
399 0.36
400 0.34
401 0.33
402 0.28
403 0.24
404 0.21
405 0.17
406 0.16
407 0.16
408 0.15
409 0.13
410 0.11
411 0.11
412 0.1
413 0.09
414 0.09
415 0.09
416 0.08
417 0.07
418 0.07
419 0.08
420 0.08
421 0.1
422 0.13
423 0.15
424 0.18
425 0.18
426 0.17
427 0.17
428 0.16
429 0.15
430 0.11
431 0.11
432 0.1
433 0.1
434 0.1
435 0.11
436 0.12
437 0.15
438 0.22
439 0.26
440 0.3
441 0.4
442 0.49
443 0.57
444 0.66
445 0.72
446 0.76
447 0.81
448 0.81
449 0.84
450 0.84
451 0.85
452 0.81
453 0.79
454 0.75
455 0.74
456 0.71
457 0.61
458 0.54
459 0.47
460 0.43
461 0.37
462 0.33
463 0.23
464 0.19
465 0.17
466 0.14
467 0.12
468 0.09
469 0.17
470 0.22
471 0.3
472 0.4
473 0.47
474 0.58
475 0.65
476 0.74
477 0.74
478 0.79
479 0.81
480 0.83
481 0.86
482 0.85
483 0.87
484 0.85