Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M6X146

Protein Details
Accession A0A3M6X146    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-36GSSGKGTPRRKMKKVHKSSGTBasic
NLS Segment(s)
PositionSequence
19-33GKGTPRRKMKKVHKS
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039370  BTF3  
IPR038187  NAC_A/B_dom_sf  
IPR002715  Nas_poly-pep-assoc_cplx_dom  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF01849  NAC  
PROSITE View protein in PROSITE  
PS51151  NAC_AB  
CDD cd22055  NAC_BTF3  
Amino Acid Sequences MDHEKLARMQNAVRIGSSGKGTPRRKMKKVHKSSGTDDKKLQGALKKLNVQPITAIEEVNMFKQDGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.23
3 0.22
4 0.21
5 0.18
6 0.19
7 0.28
8 0.32
9 0.38
10 0.48
11 0.55
12 0.59
13 0.67
14 0.72
15 0.74
16 0.8
17 0.82
18 0.79
19 0.76
20 0.75
21 0.75
22 0.7
23 0.61
24 0.52
25 0.45
26 0.39
27 0.35
28 0.32
29 0.26
30 0.26
31 0.29
32 0.34
33 0.39
34 0.39
35 0.46
36 0.44
37 0.39
38 0.36
39 0.32
40 0.32
41 0.25
42 0.23
43 0.15
44 0.18
45 0.19
46 0.19
47 0.18