Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3M7AIM3

Protein Details
Accession A0A3M7AIM3    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
20-45KVEPQEKKKTPKGRAKKRVVYTRRFVBasic
NLS Segment(s)
PositionSequence
19-37PKVEPQEKKKTPKGRAKKR
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 8.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVRSQTPKVEPQEKKKTPKGRAKKRVVYTRRFVNVTMTGGKRKMNPNPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.42
4 0.42
5 0.45
6 0.54
7 0.56
8 0.61
9 0.61
10 0.63
11 0.69
12 0.71
13 0.73
14 0.72
15 0.75
16 0.74
17 0.79
18 0.8
19 0.8
20 0.83
21 0.85
22 0.85
23 0.85
24 0.86
25 0.84
26 0.8
27 0.75
28 0.73
29 0.69
30 0.61
31 0.53
32 0.48
33 0.43
34 0.39
35 0.39
36 0.33
37 0.33
38 0.33
39 0.36
40 0.37
41 0.42
42 0.48